BO34778.complete Sequence
238 bp assembled on 2013-10-29
GenBank Submission: KX796439
> BO34778.complete
GAAGTTATCAGTCGACATGAAGCCGGGCCCATTTACGCAAGTTGACTGTA
CAAACGCCATGCATTTGAGACAACTCCTTACCGAAATGGTTATTATCTTG
ACCATATTGACCATTCCTGGCTATACCATTCACACCTTGGCAGAGAAGAA
AATCAGCCAATATCCTTGGATCCCGAAGACGTCAACGCATATTACACCTT
ATAAGATATCTGGGGATATAGCAAGCTTTCTAGACCAT
BO34778.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:32:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43185-RD | 165 | CG43185-PD | 1..162 | 59..220 | 810 | 100 | Plus |
CG43185-RC | 165 | CG43185-PC | 1..162 | 59..220 | 810 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43185-RD | 477 | CG7-RD | 179..382 | 17..220 | 1020 | 100 | Plus |
CG43185-RC | 464 | CG7-RC | 200..403 | 17..220 | 1020 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5885265..5885396 | 89..220 | 660 | 100 | Plus |
2L | 23513712 | 2L | 5885131..5885203 | 17..89 | 365 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:32:19 has no hits.
BO34778.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:33 Download gff for
BO34778.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43185-RB | 179..382 | 17..222 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:27 Download gff for
BO34778.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43185-RC | 200..403 | 17..222 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:27 Download gff for
BO34778.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5885131..5885203 | 17..89 | 100 | -> | Plus |
2L | 5885266..5885396 | 90..222 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:33 Download gff for
BO34778.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5885131..5885203 | 17..89 | 100 | -> | Plus |
arm_2L | 5885266..5885396 | 90..222 | 98 | | Plus |
BO34778.pep Sequence
Translation from 16 to 238
> BO34778.pep
MKPGPFTQVDCTNAMHLRQLLTEMVIILTILTIPGYTIHTLAEKKISQYP
WIPKTSTHITPYKISGDIASFLDH
BO34778.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43185-PD | 54 | CG43185-PD | 1..54 | 15..68 | 281 | 100 | Plus |
CG43185-PC | 54 | CG43185-PC | 1..54 | 15..68 | 281 | 100 | Plus |