Clone BO34778 Report

Search the DGRC for BO34778

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG43185-RA
Protein status:BO34778.pep: Imported from assembly
Sequenced Size:238

Clone Sequence Records

BO34778.complete Sequence

238 bp assembled on 2013-10-29

GenBank Submission: KX796439

> BO34778.complete
GAAGTTATCAGTCGACATGAAGCCGGGCCCATTTACGCAAGTTGACTGTA
CAAACGCCATGCATTTGAGACAACTCCTTACCGAAATGGTTATTATCTTG
ACCATATTGACCATTCCTGGCTATACCATTCACACCTTGGCAGAGAAGAA
AATCAGCCAATATCCTTGGATCCCGAAGACGTCAACGCATATTACACCTT
ATAAGATATCTGGGGATATAGCAAGCTTTCTAGACCAT

BO34778.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG43185-RD 165 CG43185-PD 1..162 59..220 810 100 Plus
CG43185-RC 165 CG43185-PC 1..162 59..220 810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG43185-RD 477 CG7-RD 179..382 17..220 1020 100 Plus
CG43185-RC 464 CG7-RC 200..403 17..220 1020 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5885265..5885396 89..220 660 100 Plus
2L 23513712 2L 5885131..5885203 17..89 365 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:32:19 has no hits.

BO34778.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:33 Download gff for BO34778.complete
Subject Subject Range Query Range Percent Splice Strand
CG43185-RB 179..382 17..222 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:27 Download gff for BO34778.complete
Subject Subject Range Query Range Percent Splice Strand
CG43185-RC 200..403 17..222 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:27 Download gff for BO34778.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5885131..5885203 17..89 100 -> Plus
2L 5885266..5885396 90..222 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:33 Download gff for BO34778.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5885131..5885203 17..89 100 -> Plus
arm_2L 5885266..5885396 90..222 98   Plus

BO34778.pep Sequence

Translation from 16 to 238

> BO34778.pep
MKPGPFTQVDCTNAMHLRQLLTEMVIILTILTIPGYTIHTLAEKKISQYP
WIPKTSTHITPYKISGDIASFLDH

BO34778.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG43185-PD 54 CG43185-PD 1..54 15..68 281 100 Plus
CG43185-PC 54 CG43185-PC 1..54 15..68 281 100 Plus