BO34785.complete Sequence
151 bp assembled on 2013-11-25
GenBank Submission: KX795186
> BO34785.complete
GAAGTTATCAGTCGACATGAAAGTCTTCGGAACTATTCTTATGTTGGCAA
TTTTAGCCCTAGATGTGTGCAATGCAGTAAAATGTGTTTTAACTTGTCGT
ACATCGGCTGGCGACTACGAAGTCATTGAGATAGCAAGCTTTCTAGACCA
T
BO34785.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:35:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43251-RA | 120 | CG43251-PA | 1..117 | 17..133 | 585 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:35:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43251-RA | 250 | CG43251-RA | 34..150 | 17..133 | 585 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:35:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 20759006..20759092 | 47..133 | 435 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:35:57 has no hits.
BO34785.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-11-25 13:38:32 Download gff for
BO34785.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43251-RA | 34..150 | 17..135 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:17:59 Download gff for
BO34785.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43251-RA | 34..150 | 17..135 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:17:59 Download gff for
BO34785.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20758916..20758946 | 17..47 | 100 | -> | Plus |
3L | 20759007..20759092 | 48..135 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-11-25 13:38:32 Download gff for
BO34785.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 20752016..20752046 | 17..47 | 100 | -> | Plus |
arm_3L | 20752107..20752192 | 48..135 | 97 | | Plus |
BO34785.pep Sequence
Translation from 16 to 151
> BO34785.pep
MKVFGTILMLAILALDVCNAVKCVLTCRTSAGDYEVIEIASFLDH
BO34785.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:46:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43251-PA | 39 | CG43251-PA | 1..39 | 1..39 | 196 | 100 | Plus |