Clone BO34785 Report

Search the DGRC for BO34785

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG43251-RA
Protein status:BO34785.pep: Imported from assembly
Sequenced Size:151

Clone Sequence Records

BO34785.complete Sequence

151 bp assembled on 2013-11-25

GenBank Submission: KX795186

> BO34785.complete
GAAGTTATCAGTCGACATGAAAGTCTTCGGAACTATTCTTATGTTGGCAA
TTTTAGCCCTAGATGTGTGCAATGCAGTAAAATGTGTTTTAACTTGTCGT
ACATCGGCTGGCGACTACGAAGTCATTGAGATAGCAAGCTTTCTAGACCA
T

BO34785.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG43251-RA 120 CG43251-PA 1..117 17..133 585 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG43251-RA 250 CG43251-RA 34..150 17..133 585 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20759006..20759092 47..133 435 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:35:57 has no hits.

BO34785.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-11-25 13:38:32 Download gff for BO34785.complete
Subject Subject Range Query Range Percent Splice Strand
CG43251-RA 34..150 17..135 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:17:59 Download gff for BO34785.complete
Subject Subject Range Query Range Percent Splice Strand
CG43251-RA 34..150 17..135 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:17:59 Download gff for BO34785.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20758916..20758946 17..47 100 -> Plus
3L 20759007..20759092 48..135 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-11-25 13:38:32 Download gff for BO34785.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20752016..20752046 17..47 100 -> Plus
arm_3L 20752107..20752192 48..135 97   Plus

BO34785.pep Sequence

Translation from 16 to 151

> BO34785.pep
MKVFGTILMLAILALDVCNAVKCVLTCRTSAGDYEVIEIASFLDH

BO34785.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG43251-PA 39 CG43251-PA 1..39 1..39 196 100 Plus