Clone BO34786 Report

Search the DGRC for BO34786

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG43249-RA
Protein status:BO34786.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO34786.complete Sequence

265 bp assembled on 2013-10-29

GenBank Submission: KX798377

> BO34786.complete
GAAGTTATCAGTCGACATGGATTACCTGTTGAAAGCGATATTTGTTCTAA
TCCTTCTGAGCATCCACTGCACCAATGGATATGTTAATGGCCGCCACGAG
ATAGTCAGAAGGGAGGTGAACGTGACAGAGGTGGATCGCGGATTGAGTGG
AGCACTAACCATGTTTTTCCAGCCCCTTGCTGATTTTGCTGCCAAGTTAA
AGATGGAGATACCCATGATTACACACTTCCGCACCAAACATTTTAACGCA
AGCTTTCTAGACCAT

BO34786.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG43249-RA 234 CG43249-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG43249-RA 324 CG43249-RA 19..249 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16304377..16304587 37..247 1055 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:32:39 has no hits.

BO34786.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:44 Download gff for BO34786.complete
Subject Subject Range Query Range Percent Splice Strand
CG43249-RA 19..249 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:39 Download gff for BO34786.complete
Subject Subject Range Query Range Percent Splice Strand
CG43249-RA 19..249 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:39 Download gff for BO34786.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16304300..16304320 17..37 100 -> Plus
3L 16304378..16304587 38..249 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:44 Download gff for BO34786.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16297400..16297420 17..37 100 -> Plus
arm_3L 16297478..16297687 38..249 99   Plus

BO34786.pep Sequence

Translation from 16 to 265

> BO34786.pep
MDYLLKAIFVLILLSIHCTNGYVNGRHEIVRREVNVTEVDRGLSGALTMF
FQPLADFAAKLKMEIPMITHFRTKHFNASFLDH

BO34786.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG43249-PA 77 CG43249-PA 1..77 1..77 398 100 Plus