BO34786.complete Sequence
265 bp assembled on 2013-10-29
GenBank Submission: KX798377
> BO34786.complete
GAAGTTATCAGTCGACATGGATTACCTGTTGAAAGCGATATTTGTTCTAA
TCCTTCTGAGCATCCACTGCACCAATGGATATGTTAATGGCCGCCACGAG
ATAGTCAGAAGGGAGGTGAACGTGACAGAGGTGGATCGCGGATTGAGTGG
AGCACTAACCATGTTTTTCCAGCCCCTTGCTGATTTTGCTGCCAAGTTAA
AGATGGAGATACCCATGATTACACACTTCCGCACCAAACATTTTAACGCA
AGCTTTCTAGACCAT
BO34786.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:32:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43249-RA | 234 | CG43249-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43249-RA | 324 | CG43249-RA | 19..249 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16304377..16304587 | 37..247 | 1055 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:32:39 has no hits.
BO34786.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:44 Download gff for
BO34786.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43249-RA | 19..249 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:39 Download gff for
BO34786.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43249-RA | 19..249 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:39 Download gff for
BO34786.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16304300..16304320 | 17..37 | 100 | -> | Plus |
3L | 16304378..16304587 | 38..249 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:44 Download gff for
BO34786.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16297400..16297420 | 17..37 | 100 | -> | Plus |
arm_3L | 16297478..16297687 | 38..249 | 99 | | Plus |
BO34786.pep Sequence
Translation from 16 to 265
> BO34786.pep
MDYLLKAIFVLILLSIHCTNGYVNGRHEIVRREVNVTEVDRGLSGALTMF
FQPLADFAAKLKMEIPMITHFRTKHFNASFLDH
BO34786.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43249-PA | 77 | CG43249-PA | 1..77 | 1..77 | 398 | 100 | Plus |