BO34787.complete Sequence
154 bp assembled on 2013-10-29
GenBank Submission: KX796143
> BO34787.complete
GAAGTTATCAGTCGACATGCCTTGCCCATGCGGAAGCGGATGCAAATGCG
CCAGCCAGGCCACCAAGGGATCCTGCAACTGCGGATCTGACTGCAAGTGC
GGCGGCGACAAGAAATCCGCCTGCGGCTGCTCCGAGGCAAGCTTTCTAGA
CCAT
BO34787.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:30:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MtnA-RB | 123 | CG9470-PB | 1..120 | 17..136 | 600 | 100 | Plus |
MtnA-RA | 123 | CG9470-PA | 1..120 | 17..136 | 600 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MtnA-RB | 700 | CG9470-RB | 126..245 | 17..136 | 600 | 100 | Plus |
MtnA-RA | 329 | CG9470-RA | 126..245 | 17..136 | 600 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 9783862..9783960 | 136..38 | 495 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:30:14 has no hits.
BO34787.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:41 Download gff for
BO34787.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
MtnA-RA | 126..245 | 17..138 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:15:27 Download gff for
BO34787.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
MtnA-RA | 126..245 | 17..138 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:15:27 Download gff for
BO34787.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9783859..9783959 | 39..138 | 98 | <- | Minus |
3R | 9784224..9784245 | 17..38 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:41 Download gff for
BO34787.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 5609581..5609681 | 39..138 | 98 | <- | Minus |
arm_3R | 5609946..5609967 | 17..38 | 100 | | Minus |
BO34787.pep Sequence
Translation from 16 to 154
> BO34787.pep
MPCPCGSGCKCASQATKGSCNCGSDCKCGGDKKSACGCSEASFLDH
BO34787.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MtnA-PB | 40 | CG9470-PB | 1..40 | 1..40 | 245 | 100 | Plus |
MtnA-PA | 40 | CG9470-PA | 1..40 | 1..40 | 245 | 100 | Plus |