Clone BO34787 Report

Search the DGRC for BO34787

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptMtnA-RA
Protein status:BO34787.pep: Imported from assembly
Sequenced Size:154

Clone Sequence Records

BO34787.complete Sequence

154 bp assembled on 2013-10-29

GenBank Submission: KX796143

> BO34787.complete
GAAGTTATCAGTCGACATGCCTTGCCCATGCGGAAGCGGATGCAAATGCG
CCAGCCAGGCCACCAAGGGATCCTGCAACTGCGGATCTGACTGCAAGTGC
GGCGGCGACAAGAAATCCGCCTGCGGCTGCTCCGAGGCAAGCTTTCTAGA
CCAT

BO34787.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA-RB 123 CG9470-PB 1..120 17..136 600 100 Plus
MtnA-RA 123 CG9470-PA 1..120 17..136 600 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA-RB 700 CG9470-RB 126..245 17..136 600 100 Plus
MtnA-RA 329 CG9470-RA 126..245 17..136 600 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9783862..9783960 136..38 495 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:30:14 has no hits.

BO34787.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:41 Download gff for BO34787.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 126..245 17..138 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:15:27 Download gff for BO34787.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 126..245 17..138 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:15:27 Download gff for BO34787.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9783859..9783959 39..138 98 <- Minus
3R 9784224..9784245 17..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:41 Download gff for BO34787.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5609581..5609681 39..138 98 <- Minus
arm_3R 5609946..5609967 17..38 100   Minus

BO34787.pep Sequence

Translation from 16 to 154

> BO34787.pep
MPCPCGSGCKCASQATKGSCNCGSDCKCGGDKKSACGCSEASFLDH

BO34787.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA-PB 40 CG9470-PB 1..40 1..40 245 100 Plus
MtnA-PA 40 CG9470-PA 1..40 1..40 245 100 Plus