Clone BO34789 Report

Search the DGRC for BO34789

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG43134-RA
Protein status:BO34789.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO34789.complete Sequence

280 bp assembled on 2013-11-25

GenBank Submission: KX797523

> BO34789.complete
GAAGTTATCAGTCGACATGTTCAACAAAACGATTTTCGTAGCCCTCCTTG
TCTGCGCCTGCTACCTTGGCACAAGTGAGGCTCGCCCAGGACTTACCGAT
GTGGCCTCTGGACCAGTTGGATCAGCCGTGCCATTGGTAACTGGAGCTCT
TGGTGGCCTAACTGGAGGAGTAGCTGGCTCTGCTCTGCCTCAGCTGACTG
GTTCTCTTGGCCAGTCAGGACCTTTGGGATTGGCCCAAGGACCACTTTCA
GGACTTACCGGTGCAAGCTTTCTAGACCAT

BO34789.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG43134-RA 249 CG43134-PA 1..246 17..262 1215 99.6 Plus
CG43134-RB 249 CG43134-PB 1..246 17..262 1215 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG43134-RA 407 CG43134-RA 31..276 17..262 1215 99.6 Plus
CG43134-RB 323 CG43134-RB 31..276 17..262 1215 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4247448..4247654 56..262 1020 99.5 Plus
X 23542271 X 4247343..4247382 17..56 200 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:35:49 has no hits.

BO34789.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-11-25 13:38:27 Download gff for BO34789.complete
Subject Subject Range Query Range Percent Splice Strand
CG43134-RB 36..276 22..264 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:17:54 Download gff for BO34789.complete
Subject Subject Range Query Range Percent Splice Strand
CG43134-RB 36..276 22..264 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:17:54 Download gff for BO34789.complete
Subject Subject Range Query Range Percent Splice Strand
X 4247348..4247382 22..56 100 -> Plus
X 4247449..4247654 57..264 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-11-25 13:38:27 Download gff for BO34789.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4141381..4141415 22..56 100 -> Plus
arm_X 4141482..4141687 57..264 98   Plus

BO34789.pep Sequence

Translation from 16 to 280

> BO34789.pep
MFNKTIFVALLVCACYLGTSEARPGLTDVASGPVGSAVPLVTGALGGLTG
GVAGSALPQLTGSLGQSGPLGLAQGPLSGLTGASFLDH

BO34789.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG43134-PA 82 CG43134-PA 1..82 1..82 415 100 Plus
CG43134-PB 82 CG43134-PB 1..82 1..82 415 100 Plus