Clone BO34790 Report

Search the DGRC for BO34790

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG43147-RB
Protein status:BO34790.pep: Imported from assembly
Sequenced Size:166

Clone Sequence Records

BO34790.complete Sequence

166 bp assembled on 2013-10-29

GenBank Submission: KX796577

> BO34790.complete
GAAGTTATCAGTCGACATGAAGCTACAGCTATTGGTAGTAGTACTTCTTG
GTCTTTTGGCAGTGTCCACGGCCGCACGAAAGAAAGACAAAAAAAACATT
GAGATCTGGATAAGACCGAAGCCAATGGGCTTGCCACCAGAACCGTATGC
AAGCTTTCTAGACCAT

BO34790.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG43147-RC 135 CG43147-PC 1..132 17..148 660 100 Plus
CG43147-RB 135 CG43147-PB 1..132 17..148 660 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG43147-RC 260 CG43147-RC 2..133 17..148 660 100 Plus
CG43147-RB 256 CG43147-RB 2..133 17..148 660 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13300020..13300151 148..17 660 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:30:20 has no hits.

BO34790.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:44 Download gff for BO34790.complete
Subject Subject Range Query Range Percent Splice Strand
CG43147-RB 2..133 17..150 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:15:28 Download gff for BO34790.complete
Subject Subject Range Query Range Percent Splice Strand
CG43147-RB 2..133 17..150 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:15:28 Download gff for BO34790.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13300018..13300151 17..150 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:44 Download gff for BO34790.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13293118..13293251 17..150 98   Minus

BO34790.pep Sequence

Translation from 16 to 166

> BO34790.pep
MKLQLLVVVLLGLLAVSTAARKKDKKNIEIWIRPKPMGLPPEPYASFLDH

BO34790.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG43147-PC 44 CG43147-PC 1..44 1..44 223 100 Plus
CG43147-PB 44 CG43147-PB 1..44 1..44 223 100 Plus