BO34790.complete Sequence
166 bp assembled on 2013-10-29
GenBank Submission: KX796577
> BO34790.complete
GAAGTTATCAGTCGACATGAAGCTACAGCTATTGGTAGTAGTACTTCTTG
GTCTTTTGGCAGTGTCCACGGCCGCACGAAAGAAAGACAAAAAAAACATT
GAGATCTGGATAAGACCGAAGCCAATGGGCTTGCCACCAGAACCGTATGC
AAGCTTTCTAGACCAT
BO34790.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:30:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43147-RC | 135 | CG43147-PC | 1..132 | 17..148 | 660 | 100 | Plus |
CG43147-RB | 135 | CG43147-PB | 1..132 | 17..148 | 660 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43147-RC | 260 | CG43147-RC | 2..133 | 17..148 | 660 | 100 | Plus |
CG43147-RB | 256 | CG43147-RB | 2..133 | 17..148 | 660 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13300020..13300151 | 148..17 | 660 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:30:20 has no hits.
BO34790.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:44 Download gff for
BO34790.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43147-RB | 2..133 | 17..150 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:15:28 Download gff for
BO34790.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43147-RB | 2..133 | 17..150 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:15:28 Download gff for
BO34790.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13300018..13300151 | 17..150 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:44 Download gff for
BO34790.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13293118..13293251 | 17..150 | 98 | | Minus |
BO34790.pep Sequence
Translation from 16 to 166
> BO34790.pep
MKLQLLVVVLLGLLAVSTAARKKDKKNIEIWIRPKPMGLPPEPYASFLDH
BO34790.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43147-PC | 44 | CG43147-PC | 1..44 | 1..44 | 223 | 100 | Plus |
CG43147-PB | 44 | CG43147-PB | 1..44 | 1..44 | 223 | 100 | Plus |