Clone BO34791 Report

Search the DGRC for BO34791

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptCG43254-RA
Protein status:BO34791.pep: Imported from assembly
Sequenced Size:418

Clone Sequence Records

BO34791.complete Sequence

418 bp assembled on 2013-10-29

GenBank Submission: KX799612

> BO34791.complete
GAAGTTATCAGTCGACATGGGGCGGTTGCTGTTTGTTCTTCTGATTTGTT
CCCCAATACTGTCAATTAAATTCCAAGCAAATGCAGAGGATAACTCAACA
AAGAATGGCTTAGATCGAAACAGAGAAGGAGGAGGTCATAAGGCGAATGT
ACCAGATGTTTCAAGGTTTCAAAGATCATGTTCAACTCAAGAATGTAAGG
AAAAGGAATTCAATGATATCCTCGACTCCATTCTGAGCTCGGAAACAACT
ACGGAGCCTGAACGGGAAGAGGCTCCACCGAGGAATGTTCCACAGAGACC
AAATCGACCCTACATGGTTCGACCCAGCAGTAACGGGCACTTTCTTCATG
ACATTGTAACTTGGGTTGAAAGAACAAAGAGGGCAATATTTGGATTTGGA
GCAAGCTTTCTAGACCAT

BO34791.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG43254-RA 387 CG43254-PA 1..384 17..400 1920 100 Plus
CG43254-RB 399 CG43254-PB 1..396 17..400 1765 97 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG43254-RA 479 CG43254-RA 25..408 17..400 1920 100 Plus
CG43254-RB 491 CG43254-RB 25..420 17..400 1765 97 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7739036..7739246 400..190 1055 100 Minus
3R 32079331 3R 7739424..7739539 132..17 580 100 Minus
3R 32079331 3R 7739296..7739357 191..130 310 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:30:23 has no hits.

BO34791.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:46:46 Download gff for BO34791.complete
Subject Subject Range Query Range Percent Splice Strand
CG43254-RA 25..408 17..402 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:15:31 Download gff for BO34791.complete
Subject Subject Range Query Range Percent Splice Strand
CG43254-RA 25..408 17..402 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:15:31 Download gff for BO34791.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7739034..7739244 192..402 99 <- Minus
3R 7739296..7739355 132..191 100 <- Minus
3R 7739425..7739539 17..131 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:46:46 Download gff for BO34791.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3564756..3564966 192..402 99 <- Minus
arm_3R 3565018..3565077 132..191 100 <- Minus
arm_3R 3565147..3565261 17..131 100   Minus

BO34791.pep Sequence

Translation from 16 to 418

> BO34791.pep
MGRLLFVLLICSPILSIKFQANAEDNSTKNGLDRNREGGGHKANVPDVSR
FQRSCSTQECKEKEFNDILDSILSSETTTEPEREEAPPRNVPQRPNRPYM
VRPSSNGHFLHDIVTWVERTKRAIFGFGASFLDH

BO34791.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG43254-PA 128 CG43254-PA 1..128 1..128 678 100 Plus
CG43254-PB 132 CG43254-PB 1..132 1..128 663 97 Plus