Clone BO34795 Report

Search the DGRC for BO34795

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:347
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG43235-RA
Protein status:BO34795.pep: Imported from assembly
Sequenced Size:343

Clone Sequence Records

BO34795.complete Sequence

343 bp assembled on 2013-10-29

GenBank Submission: KX794092

> BO34795.complete
GAAGTTATCAGTCGACATGCGTCCACAGATTGCAATGTTACTATTGATAA
CTGCTTGGAAAAGTAGCCTATCAGATCCGATAGGTCCCCGTTCCTATGAA
AACTATTCAGTGTATAAGGTTTTCATTAAAACTCGGTCGGATCAACAGGT
TATCGATGGACTGCTGAAGGACACAGACAATTATAACTTGTGGCATCGTG
GCTTAAATGTAGTTCACATAATGGTGAGCCCTGTGGAAAAGGATTCTTTC
CTAGCTGTAATGCAAAAGGAAAATATTGTTGTGGAAGTACTTATAAAAAA
TGTTCAGACACTTATTGATAGATACGCAAGCTTTCTAGACCAT

BO34795.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG43235-RA 312 CG43235-PA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG43235-RA 678 CG43235-RA 107..422 10..325 1550 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7693136..7693307 10..181 830 98.8 Plus
2L 23513712 2L 7693365..7693492 182..309 640 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:32:34 has no hits.

BO34795.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-10-29 16:47:40 Download gff for BO34795.complete
Subject Subject Range Query Range Percent Splice Strand
CG43235-RA 114..422 17..327 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:16:35 Download gff for BO34795.complete
Subject Subject Range Query Range Percent Splice Strand
CG43235-RA 114..422 17..327 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:16:35 Download gff for BO34795.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7693143..7693307 17..181 100 -> Plus
2L 7693365..7693492 182..309 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-10-29 16:47:40 Download gff for BO34795.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7693143..7693307 17..181 100 -> Plus
arm_2L 7693365..7693492 182..309 100 -> Plus

BO34795.pep Sequence

Translation from 16 to 343

> BO34795.pep
MRPQIAMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLL
KDTDNYNLWHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI
DRYASFLDH

BO34795.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG43235-PA 103 CG43235-PA 1..103 1..103 526 100 Plus
CG7025-PA 429 CG7025-PA 8..103 5..101 166 36.1 Plus