Clone BO34958 Report

Search the DGRC for BO34958

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:349
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG12643-RA
Protein status:BO34958.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO34958.complete Sequence

265 bp assembled on 2013-12-04

GenBank Submission: KX799138

> BO34958.complete
GAAGTTATCAGTCGACATGCCGTTCCCCATCCATCCGCCCAAGCAGATGC
CCTGCCCCCACTGGCAGCACTTCCCCATCAGTCCCGTGGACAGTAAGCCG
AATCCATTCGATTCCGTCGGCGGAGCGGCAGCAGCGGCCACCCAGGTCAA
CATAGGGGTTAACAAGCCACCGGAGCCGGTATCCTATCGCTATTGTTTGC
AGTGCAAGAACTCCGGCAAGGAGCCAATAAACCCCGCCGACAGGGAGGCA
AGCTTTCTAGACCAT

BO34958.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12643-RA 234 CG12643-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12643-RA 1031 CG12643-RA 190..420 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10264844..10265074 247..17 1155 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:37:04 has no hits.

BO34958.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:06 Download gff for BO34958.complete
Subject Subject Range Query Range Percent Splice Strand
CG12643-RA 190..420 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:18:26 Download gff for BO34958.complete
Subject Subject Range Query Range Percent Splice Strand
CG12643-RA 190..420 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:18:26 Download gff for BO34958.complete
Subject Subject Range Query Range Percent Splice Strand
X 10264840..10265074 17..249 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:06 Download gff for BO34958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10158873..10159107 17..249 99   Minus

BO34958.pep Sequence

Translation from 16 to 265

> BO34958.pep
MPFPIHPPKQMPCPHWQHFPISPVDSKPNPFDSVGGAAAAATQVNIGVNK
PPEPVSYRYCLQCKNSGKEPINPADREASFLDH

BO34958.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG12643-PA 77 CG12643-PA 1..77 1..77 440 100 Plus