BO34960.complete Sequence
175 bp assembled on 2013-12-04
GenBank Submission: KX793818
> BO34960.complete
GAAGTTATCAGTCGACATGCTGCGCGATATCTTTCTGTATTTAGTTCTAA
TCGTTTTATTTTGCTTCATTTTCATGGCGCAGTTAATCGTCAACGTTTAC
GCCTTCCAGCGCCAGCCGTCGCCCAACAAAGCGGAGCGCAATGAAATTAT
ATTTGTCGCAAGCTTTCTAGACCAT
BO34960.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:37:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34155-RA | 144 | CG34155-PA | 1..141 | 17..157 | 705 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34155-RA | 2619 | CG34155-RA | 413..553 | 17..157 | 705 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 30556620..30556760 | 157..17 | 705 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:37:07 has no hits.
BO34960.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:07 Download gff for
BO34960.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34155-RA | 413..553 | 17..159 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:18:28 Download gff for
BO34960.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34155-RA | 413..553 | 17..159 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:18:28 Download gff for
BO34960.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30556618..30556760 | 17..159 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:07 Download gff for
BO34960.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 26382340..26382482 | 17..159 | 98 | | Minus |
BO34960.pep Sequence
Translation from 16 to 175
> BO34960.pep
MLRDIFLYLVLIVLFCFIFMAQLIVNVYAFQRQPSPNKAERNEIIFVASF
LDH
BO34960.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:47:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34155-PA | 47 | CG34155-PA | 1..47 | 1..47 | 236 | 100 | Plus |