Clone BO34960 Report

Search the DGRC for BO34960

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:349
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptCG34155-RA
Protein status:BO34960.pep: Imported from assembly
Sequenced Size:175

Clone Sequence Records

BO34960.complete Sequence

175 bp assembled on 2013-12-04

GenBank Submission: KX793818

> BO34960.complete
GAAGTTATCAGTCGACATGCTGCGCGATATCTTTCTGTATTTAGTTCTAA
TCGTTTTATTTTGCTTCATTTTCATGGCGCAGTTAATCGTCAACGTTTAC
GCCTTCCAGCGCCAGCCGTCGCCCAACAAAGCGGAGCGCAATGAAATTAT
ATTTGTCGCAAGCTTTCTAGACCAT

BO34960.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34155-RA 144 CG34155-PA 1..141 17..157 705 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34155-RA 2619 CG34155-RA 413..553 17..157 705 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30556620..30556760 157..17 705 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:37:07 has no hits.

BO34960.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:07 Download gff for BO34960.complete
Subject Subject Range Query Range Percent Splice Strand
CG34155-RA 413..553 17..159 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:18:28 Download gff for BO34960.complete
Subject Subject Range Query Range Percent Splice Strand
CG34155-RA 413..553 17..159 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:18:28 Download gff for BO34960.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30556618..30556760 17..159 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:07 Download gff for BO34960.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26382340..26382482 17..159 98   Minus

BO34960.pep Sequence

Translation from 16 to 175

> BO34960.pep
MLRDIFLYLVLIVLFCFIFMAQLIVNVYAFQRQPSPNKAERNEIIFVASF
LDH

BO34960.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34155-PA 47 CG34155-PA 1..47 1..47 236 100 Plus