Clone BO35062 Report

Search the DGRC for BO35062

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:350
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG42518-RA
Protein status:BO35062.pep: Imported from assembly
Sequenced Size:289

Clone Sequence Records

BO35062.complete Sequence

289 bp assembled on 2013-12-04

GenBank Submission: KX797962

> BO35062.complete
GAAGTTATCAGTCGACATGGTGCTGCGACTGCTAATGCGCTACCTGGCCA
ACAACGAGCAGCTCATCCAGCGCATGGCGGAGAGCTATCCCATGAGACGC
GCTGCCCAGTTGGTCGTTTCCCTGATGTACCGCACAAAAGACTTGGCCCG
GGAGCAGGGACTGCACGAGATGACGCCAGAGCGTTTCAAATCCTTCGTTA
ACATGTTTAAGAACAACGTGCGCCAAGAGCTGGAGGGAGTGAAGAAGGAG
CTTAATAGCAAGAAAAAGAACGCAAGCTTTCTAGACCAT

BO35062.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG42518-RB 258 CG42518-PB 1..255 17..271 1275 100 Plus
CG42518-RA 258 CG42518-PA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
MED9-RC 871 CG42517-RC 526..780 17..271 1275 100 Plus
CG42518-RB 825 CG42518-RB 480..734 17..271 1275 100 Plus
CG42518-RA 871 CG42518-RA 526..780 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18167966..18168138 17..189 865 100 Plus
2R 25286936 2R 18168208..18168289 190..271 410 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:38:09 has no hits.

BO35062.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:34 Download gff for BO35062.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 526..768 17..259 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:18:59 Download gff for BO35062.complete
Subject Subject Range Query Range Percent Splice Strand
CG42518-RA 526..768 17..259 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:18:59 Download gff for BO35062.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18167966..18168138 17..189 100 -> Plus
2R 18168208..18168277 190..259 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:34 Download gff for BO35062.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14055471..14055643 17..189 100 -> Plus
arm_2R 14055713..14055782 190..259 100   Plus

BO35062.pep Sequence

Translation from 16 to 289

> BO35062.pep
MVLRLLMRYLANNEQLIQRMAESYPMRRAAQLVVSLMYRTKDLAREQGLH
EMTPERFKSFVNMFKNNVRQELEGVKKELNSKKKNASFLDH

BO35062.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42518-PB 85 CG42518-PB 1..85 1..85 424 100 Plus
CG42518-PA 85 CG5134-PB 1..85 1..85 424 100 Plus