Clone BO35063 Report

Search the DGRC for BO35063

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:350
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptCG1418-RB
Protein status:BO35063.pep: Imported from assembly
Sequenced Size:391

Clone Sequence Records

BO35063.complete Sequence

391 bp assembled on 2013-12-04

GenBank Submission: KX794489

> BO35063.complete
GAAGTTATCAGTCGACATGGCACACACTGGCGGGAACCTATCCGGTAACA
TGCAGCCGCCACCGCCTTCCGGAGGCAGGTTCTCCGTGGACATGCAAAGC
CTGCCCTCGCTATCCAACCTGCCATCACCGCTGCAGATCTTCCAAATGGT
CCGAAACTCCCTGCGGCCCTGGGTAGTCTTCTTCAACATCAACAATTTCA
AAACGGCCATCAGCATGCAGCGGCTAAATAGCCGGGTTATTCGGAATCTC
TCCTATTTTCAGGCCAACTACGTTTTCATCTTTTTTGTACTGATGATATA
CTGCCTTTATAATCTTAAGCATCACGGCTCCCTGCATTCTGCTGGTCATC
CTGGCTTCCGCTTTTGGCTGCCAGCAAGCTTTCTAGACCAT

BO35063.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG1418-RA 582 CG1418-PA 1..344 17..373 1555 96.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG1418-RA 1128 CG1418-RA 352..695 17..373 1555 96.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9964375..9964583 306..98 1045 100 Minus
2R 25286936 2R 9964634..9964716 99..17 415 100 Minus
2R 25286936 2R 9964268..9964334 373..307 335 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:38:14 has no hits.

BO35063.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:35 Download gff for BO35063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1418-RB 352..708 17..375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:19:01 Download gff for BO35063.complete
Subject Subject Range Query Range Percent Splice Strand
CG1418-RA 352..641 17..306 100 == Plus
CG1418-RA 642..695 320..375 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:01 Download gff for BO35063.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9964266..9964334 307..375 97 <- Minus
2R 9964375..9964581 100..306 100 <- Minus
2R 9964634..9964716 17..99 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:35 Download gff for BO35063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5851771..5851839 307..375 97 <- Minus
arm_2R 5851880..5852086 100..306 100 <- Minus
arm_2R 5852139..5852221 17..99 100   Minus

BO35063.pep Sequence

Translation from 16 to 391

> BO35063.pep
MAHTGGNLSGNMQPPPPSGGRFSVDMQSLPSLSNLPSPLQIFQMVRNSLR
PWVVFFNINNFKTAISMQRLNSRVIRNLSYFQANYVFIFFVLMIYCLYNL
KHHGSLHSAGHPGFRFWLPASFLDH

BO35063.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG1418-PA 193 CG1418-PA 1..97 1..97 508 100 Plus