BO35066.complete Sequence
169 bp assembled on 2013-12-04
GenBank Submission: KX793776
> BO35066.complete
GAAGTTATCAGTCGACATGGAGCACATTCGATTTGTTGACAAAGTCTTTA
GAGCCCTGATCGCCGGCACCCTGCTGCTCCTGATGACCGCCATTTACCGG
GAGGACAACAACTCCGGATCCCACTACATCCATCCAAGACACGCCATGCA
GGCAAGCTTTCTAGACCAT
BO35066.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:38:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42662-RC | 138 | CG42662-PC | 1..135 | 17..151 | 675 | 100 | Plus |
CG42662-RD | 138 | CG42662-PD | 1..135 | 17..151 | 675 | 100 | Plus |
CG42662-RB | 138 | CG42662-PB | 1..135 | 17..151 | 675 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42662-RC | 1695 | CG42662-RC | 1266..1402 | 15..151 | 685 | 100 | Plus |
CG42662-RD | 500 | CG42662-RD | 71..207 | 15..151 | 685 | 100 | Plus |
CG42662-RB | 2791 | CG42662-RB | 2362..2498 | 15..151 | 685 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 15699019..15699155 | 151..15 | 685 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:38:17 has no hits.
BO35066.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:38 Download gff for
BO35066.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42662-RC | 1268..1402 | 17..153 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:19:02 Download gff for
BO35066.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42662-RB | 2364..2498 | 17..153 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:02 Download gff for
BO35066.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 15699015..15699153 | 17..153 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:38 Download gff for
BO35066.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 11586520..11586658 | 17..153 | 98 | | Minus |
BO35066.pep Sequence
Translation from 16 to 169
> BO35066.pep
MEHIRFVDKVFRALIAGTLLLLMTAIYREDNNSGSHYIHPRHAMQASFLD
H
BO35066.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:48:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42662-PC | 45 | CG42662-PC | 1..45 | 1..45 | 234 | 100 | Plus |
CG42662-PD | 45 | CG42662-PD | 1..45 | 1..45 | 234 | 100 | Plus |
CG42662-PB | 45 | CG42662-PB | 1..45 | 1..45 | 234 | 100 | Plus |
CG42662-PA | 45 | CG42662-PA | 1..45 | 1..45 | 234 | 100 | Plus |