Clone BO35066 Report

Search the DGRC for BO35066

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:350
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG42662-RA
Protein status:BO35066.pep: Imported from assembly
Sequenced Size:169

Clone Sequence Records

BO35066.complete Sequence

169 bp assembled on 2013-12-04

GenBank Submission: KX793776

> BO35066.complete
GAAGTTATCAGTCGACATGGAGCACATTCGATTTGTTGACAAAGTCTTTA
GAGCCCTGATCGCCGGCACCCTGCTGCTCCTGATGACCGCCATTTACCGG
GAGGACAACAACTCCGGATCCCACTACATCCATCCAAGACACGCCATGCA
GGCAAGCTTTCTAGACCAT

BO35066.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG42662-RC 138 CG42662-PC 1..135 17..151 675 100 Plus
CG42662-RD 138 CG42662-PD 1..135 17..151 675 100 Plus
CG42662-RB 138 CG42662-PB 1..135 17..151 675 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG42662-RC 1695 CG42662-RC 1266..1402 15..151 685 100 Plus
CG42662-RD 500 CG42662-RD 71..207 15..151 685 100 Plus
CG42662-RB 2791 CG42662-RB 2362..2498 15..151 685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15699019..15699155 151..15 685 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:38:17 has no hits.

BO35066.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:38 Download gff for BO35066.complete
Subject Subject Range Query Range Percent Splice Strand
CG42662-RC 1268..1402 17..153 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:19:02 Download gff for BO35066.complete
Subject Subject Range Query Range Percent Splice Strand
CG42662-RB 2364..2498 17..153 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:02 Download gff for BO35066.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15699015..15699153 17..153 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:38 Download gff for BO35066.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11586520..11586658 17..153 98   Minus

BO35066.pep Sequence

Translation from 16 to 169

> BO35066.pep
MEHIRFVDKVFRALIAGTLLLLMTAIYREDNNSGSHYIHPRHAMQASFLD
H

BO35066.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG42662-PC 45 CG42662-PC 1..45 1..45 234 100 Plus
CG42662-PD 45 CG42662-PD 1..45 1..45 234 100 Plus
CG42662-PB 45 CG42662-PB 1..45 1..45 234 100 Plus
CG42662-PA 45 CG42662-PA 1..45 1..45 234 100 Plus