Clone BO35105 Report

Search the DGRC for BO35105

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:351
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG43083-RA
Protein status:BO35105.pep: Imported from assembly
Sequenced Size:424

Clone Sequence Records

BO35105.complete Sequence

424 bp assembled on 2013-12-04

GenBank Submission: KX797735

> BO35105.complete
GAAGTTATCAGTCGACATGGGATTTATTATAAATTTTAATTTATTTTGCG
TTCTACTGCTAGTTGACTTTGGACAACCAGAATATGCAGAATATTTCAAT
CCAGAAGAGCCCTTAGATGATCACCTAACACGGCCAGATGAGGATGTGGC
AAGTAGTGATAATGAGATGACAATGTCGTATGATTATCACAATGAAAACC
ATGACAGTACTAACCACCCAGGTCCTCAAGAAGATGCTACAACTGATAAT
TATGTCGAATCGTACGTTGATCATTATACCACTGGAATGGATAATCTTGA
AGAAAATCAGCAAGACACAGATTACGGTCAGTATGAGCCACACGTTGAAC
ATGAAATTGAAGATCGGATAGTGCGATATGCGATGCATAAGTGGCGCGAA
GAAATTGCAAGCTTTCTAGACCAT

BO35105.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43083-RA 393 CG43083-PA 1..390 17..406 1950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG43083-RA 430 CG43083-RA 4..395 15..406 1960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15648681..15648918 65..302 1190 100 Plus
3L 28110227 3L 15648985..15649090 301..406 530 100 Plus
3L 28110227 3L 15648574..15648624 15..65 255 100 Plus
Blast to na_te.dros performed 2014-11-28 14:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 521..548 53..26 104 85.7 Minus

BO35105.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:44 Download gff for BO35105.complete
Subject Subject Range Query Range Percent Splice Strand
CG43083-RA 6..395 17..408 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:19:12 Download gff for BO35105.complete
Subject Subject Range Query Range Percent Splice Strand
CG43083-RA 6..395 17..408 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:12 Download gff for BO35105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15648682..15648918 66..302 100 -> Plus
3L 15648987..15649090 303..408 98   Plus
3L 15648576..15648624 17..65 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:44 Download gff for BO35105.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15641782..15642018 66..302 100 -> Plus
arm_3L 15642087..15642190 303..408 98   Plus
arm_3L 15641676..15641724 17..65 100 -> Plus

BO35105.pep Sequence

Translation from 16 to 424

> BO35105.pep
MGFIINFNLFCVLLLVDFGQPEYAEYFNPEEPLDDHLTRPDEDVASSDNE
MTMSYDYHNENHDSTNHPGPQEDATTDNYVESYVDHYTTGMDNLEENQQD
TDYGQYEPHVEHEIEDRIVRYAMHKWREEIASFLDH

BO35105.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG43083-PA 130 CG43083-PA 1..130 1..130 725 100 Plus