Clone BO35138 Report

Search the DGRC for BO35138

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:351
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG43253-RA
Protein status:BO35138.pep: Imported from assembly
Sequenced Size:223

Clone Sequence Records

BO35138.complete Sequence

223 bp assembled on 2013-12-04

GenBank Submission: KX794129

> BO35138.complete
GAAGTTATCAGTCGACATGCCCAGCTCCATGATGTCCGTGATGATGATTA
CGCTGCACTCGCTGAGCCTGAGCTGGATTTTTAATTGGCCTAGTCCATTG
AGTGCTCCATTTGCCGGTTTCCCATCTGTGTACTCATCAGATATCTGCTG
GCCAAGGTGCCAGTGGGGTGAATTGCAGGGCAGATGCCCAACGATAATGG
ACAGCGCAAGCTTTCTAGACCAT

BO35138.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:40:12 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:40:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18081341..18081529 205..17 945 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:40:11 has no hits.

BO35138.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:00:19 Download gff for BO35138.complete
Subject Subject Range Query Range Percent Splice Strand
CG43253-RA 420..608 17..207 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:53 Download gff for BO35138.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18081338..18081529 17..207 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:53 Download gff for BO35138.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18081338..18081529 17..207 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:00:19 Download gff for BO35138.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18074438..18074629 17..207 98   Minus

BO35138.pep Sequence

Translation from 16 to 223

> BO35138.pep
MPSSMMSVMMITLHSLSLSWIFNWPSPLSAPFAGFPSVYSSDICWPRCQW
GELQGRCPTIMDSASFLDH
Sequence BO35138.pep has no blast hits.