BO35142.complete Sequence
178 bp assembled on 2013-12-04
GenBank Submission: KX795138
> BO35142.complete
GAAGTTATCAGTCGACATGCGAAACAACCAGGCAGACAACACCCAACGGC
AAAAACTCGGCCTGGAGAGAAAGAGGCAGTGGCAGCGACGCGTCTGGGGG
CTTACAATGGCGGTCGCAACACTAGTGGCGCTTGTAAATAGAGACATAAC
GAAAAGGTATGCAAGCTTTCTAGACCAT
BO35142.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:40:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43389-RA | 147 | CG43389-PA | 1..144 | 17..160 | 720 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:40:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43389-RA | 923 | CG43389-RA | 543..686 | 17..160 | 720 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:40:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3248664..3248807 | 17..160 | 720 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:40:31 has no hits.
BO35142.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:00:27 Download gff for
BO35142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43389-RA | 543..686 | 17..162 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:20:00 Download gff for
BO35142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43389-RA | 543..686 | 17..162 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:20:00 Download gff for
BO35142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3248664..3248807 | 17..162 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:00:27 Download gff for
BO35142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3248664..3248807 | 17..162 | 98 | | Plus |
BO35142.pep Sequence
Translation from 16 to 178
> BO35142.pep
MRNNQADNTQRQKLGLERKRQWQRRVWGLTMAVATLVALVNRDITKRYAS
FLDH
BO35142.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:49:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43389-PA | 48 | CG43389-PA | 1..48 | 1..48 | 248 | 100 | Plus |