Clone BO35142 Report

Search the DGRC for BO35142

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:351
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptCG43389-RA
Protein status:BO35142.pep: Imported from assembly
Sequenced Size:178

Clone Sequence Records

BO35142.complete Sequence

178 bp assembled on 2013-12-04

GenBank Submission: KX795138

> BO35142.complete
GAAGTTATCAGTCGACATGCGAAACAACCAGGCAGACAACACCCAACGGC
AAAAACTCGGCCTGGAGAGAAAGAGGCAGTGGCAGCGACGCGTCTGGGGG
CTTACAATGGCGGTCGCAACACTAGTGGCGCTTGTAAATAGAGACATAAC
GAAAAGGTATGCAAGCTTTCTAGACCAT

BO35142.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG43389-RA 147 CG43389-PA 1..144 17..160 720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG43389-RA 923 CG43389-RA 543..686 17..160 720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3248664..3248807 17..160 720 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:40:31 has no hits.

BO35142.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:00:27 Download gff for BO35142.complete
Subject Subject Range Query Range Percent Splice Strand
CG43389-RA 543..686 17..162 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:20:00 Download gff for BO35142.complete
Subject Subject Range Query Range Percent Splice Strand
CG43389-RA 543..686 17..162 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:20:00 Download gff for BO35142.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3248664..3248807 17..162 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:00:27 Download gff for BO35142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3248664..3248807 17..162 98   Plus

BO35142.pep Sequence

Translation from 16 to 178

> BO35142.pep
MRNNQADNTQRQKLGLERKRQWQRRVWGLTMAVATLVALVNRDITKRYAS
FLDH

BO35142.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG43389-PA 48 CG43389-PA 1..48 1..48 248 100 Plus