Clone BO35143 Report

Search the DGRC for BO35143

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:351
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG43949-RA
Protein status:BO35143.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO35143.complete Sequence

280 bp assembled on 2013-12-04

GenBank Submission: KX795029

> BO35143.complete
GAAGTTATCAGTCGACATGCACAACTTTATTATCGGTTCGGCCCAGTCAC
GGTCACGTCCTTTGATCCTTTTGCCCGATTTCAGGATCCGCTGCACAACT
GTTCTCCGGTGTTTTTTCATCTTTATTTTGCGAAAAACCAAAGCGTCCGC
TCGCTGTGGGAAACGCAACAGGTGCGCCGAGGCTCCAGCATCCAGAATCC
AGCATCCAATCTCCAGTCGGCAGCAGCATTTCTCATCCATCAGCCGGCGG
AGCGAGCATCTTGCAAGCTTTCTAGACCAT

BO35143.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:40:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:40:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16020552..16020797 262..17 1230 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:40:35 has no hits.

BO35143.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:00:28 Download gff for BO35143.complete
Subject Subject Range Query Range Percent Splice Strand
CG43949-RA 710..955 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:20:02 Download gff for BO35143.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16020550..16020797 17..264 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:20:02 Download gff for BO35143.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16020550..16020797 17..264 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:00:28 Download gff for BO35143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16013650..16013897 17..264 99   Minus

BO35143.pep Sequence

Translation from 16 to 280

> BO35143.pep
MHNFIIGSAQSRSRPLILLPDFRIRCTTVLRCFFIFILRKTKASARCGKR
NRCAEAPASRIQHPISSRQQHFSSISRRSEHLASFLDH
Sequence BO35143.pep has no blast hits.