BO35147.complete Sequence
328 bp assembled on 2013-12-04
GenBank Submission: KX794206
> BO35147.complete
GAAGTTATCAGTCGACATGGAGGAGGAGCGCGAGAAGATGAGGCAAGACA
TTCGCGATAAGTACAACATCAAGAAGAAGGAGGAGATCGTGGAGGCGGCC
CCCCAAGAAGAGCCCAATCCCCTGATGCGGAAAAAGAAGACGCCCGAGGA
ACTCGCCGCCGAAGCGGAGCAGGAAGAGCTCGACGATTTTACAAGTAAGT
CTTTGCTGCCACTGTCAAGTGCCGTTGAACCTGGCTCAGCTAGTGGCATC
TATATACTGCAATTGCAACCCACTAATTTCTCCGCTCCGATTGCTCCTGC
TCCTATTCTAGCAAGCTTTCTAGACCAT
BO35147.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:39:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-RAB | 474 | CG32490-PAB | 178..471 | 17..310 | 1470 | 100 | Plus |
cpx-RZ | 297 | CG32490-PZ | 1..294 | 17..310 | 1470 | 100 | Plus |
cpx-RAA | 378 | CG32490-PAA | 127..304 | 17..194 | 890 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:39:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-RAB | 9682 | CG32490-RB | 601..894 | 17..310 | 1470 | 100 | Plus |
cpx-RZ | 2094 | CG32490-RZ | 655..948 | 17..310 | 1470 | 100 | Plus |
cpx-RAA | 3803 | CG32490-RA | 449..626 | 17..194 | 890 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:39:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 4295566..4295816 | 60..310 | 1255 | 100 | Plus |
3R | 32079331 | 3R | 4295242..4295286 | 17..61 | 225 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:39:57 has no hits.
BO35147.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:00:14 Download gff for
BO35147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RZ | 425..718 | 17..312 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:19:47 Download gff for
BO35147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RZ | 655..948 | 17..312 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:47 Download gff for
BO35147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4295242..4295286 | 17..61 | 100 | -> | Plus |
3R | 4295568..4295816 | 62..312 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:00:14 Download gff for
BO35147.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 120964..121008 | 17..61 | 100 | -> | Plus |
arm_3R | 121290..121538 | 62..312 | 99 | | Plus |
BO35147.pep Sequence
Translation from 16 to 328
> BO35147.pep
MEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKKKTPEELAAEA
EQEELDDFTSKSLLPLSSAVEPGSASGIYILQLQPTNFSAPIAPAPILAS
FLDH
BO35147.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:48:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-PZ | 98 | CG32490-PZ | 1..98 | 1..98 | 490 | 100 | Plus |
cpx-PAB | 157 | CG32490-PAB | 60..157 | 1..98 | 490 | 100 | Plus |
cpx-PE | 138 | CG32490-PE | 60..128 | 1..69 | 310 | 91.3 | Plus |
cpx-PK | 83 | CG32490-PK | 1..59 | 1..59 | 300 | 100 | Plus |
cpx-PJ | 83 | CG32490-PJ | 1..59 | 1..59 | 300 | 100 | Plus |