Clone BO35147 Report

Search the DGRC for BO35147

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:351
Well:47
Vector:pDNR-Dual
Associated Gene/Transcriptcpx-RZ
Protein status:BO35147.pep: Imported from assembly
Sequenced Size:328

Clone Sequence Records

BO35147.complete Sequence

328 bp assembled on 2013-12-04

GenBank Submission: KX794206

> BO35147.complete
GAAGTTATCAGTCGACATGGAGGAGGAGCGCGAGAAGATGAGGCAAGACA
TTCGCGATAAGTACAACATCAAGAAGAAGGAGGAGATCGTGGAGGCGGCC
CCCCAAGAAGAGCCCAATCCCCTGATGCGGAAAAAGAAGACGCCCGAGGA
ACTCGCCGCCGAAGCGGAGCAGGAAGAGCTCGACGATTTTACAAGTAAGT
CTTTGCTGCCACTGTCAAGTGCCGTTGAACCTGGCTCAGCTAGTGGCATC
TATATACTGCAATTGCAACCCACTAATTTCTCCGCTCCGATTGCTCCTGC
TCCTATTCTAGCAAGCTTTCTAGACCAT

BO35147.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RAB 474 CG32490-PAB 178..471 17..310 1470 100 Plus
cpx-RZ 297 CG32490-PZ 1..294 17..310 1470 100 Plus
cpx-RAA 378 CG32490-PAA 127..304 17..194 890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RAB 9682 CG32490-RB 601..894 17..310 1470 100 Plus
cpx-RZ 2094 CG32490-RZ 655..948 17..310 1470 100 Plus
cpx-RAA 3803 CG32490-RA 449..626 17..194 890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4295566..4295816 60..310 1255 100 Plus
3R 32079331 3R 4295242..4295286 17..61 225 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:39:57 has no hits.

BO35147.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:00:14 Download gff for BO35147.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RZ 425..718 17..312 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:19:47 Download gff for BO35147.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RZ 655..948 17..312 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:47 Download gff for BO35147.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4295242..4295286 17..61 100 -> Plus
3R 4295568..4295816 62..312 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:00:14 Download gff for BO35147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 120964..121008 17..61 100 -> Plus
arm_3R 121290..121538 62..312 99   Plus

BO35147.pep Sequence

Translation from 16 to 328

> BO35147.pep
MEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKKKTPEELAAEA
EQEELDDFTSKSLLPLSSAVEPGSASGIYILQLQPTNFSAPIAPAPILAS
FLDH

BO35147.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-PZ 98 CG32490-PZ 1..98 1..98 490 100 Plus
cpx-PAB 157 CG32490-PAB 60..157 1..98 490 100 Plus
cpx-PE 138 CG32490-PE 60..128 1..69 310 91.3 Plus
cpx-PK 83 CG32490-PK 1..59 1..59 300 100 Plus
cpx-PJ 83 CG32490-PJ 1..59 1..59 300 100 Plus