Clone BO35158 Report

Search the DGRC for BO35158

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:351
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG33785-RA
Protein status:BO35158.pep: Imported from assembly
Sequenced Size:358

Clone Sequence Records

BO35158.complete Sequence

358 bp assembled on 2013-12-04

GenBank Submission: KX796434

> BO35158.complete
GAAGTTATCAGTCGACATGTTGTTTTTCTGCCCGTCGTGCGGAAATATAT
TGATTATCGAGGAAGACACCAACTGCCATCGCTTCACGTGCAACACCTGC
CCGTACATATCGAAGATCAGGCGCAAGATCTCCACGAAAACCTTTCCACG
CCTCAAGGAGGTGGATCACGTGCTGGGCGGCAAGGCGGCGTGGGAGAACG
TAGACTCCACGGACGCAGAGTGTCCAACGTGCGGCCATAAGCGGGCGTAC
TTTATGCAAATCCAGACGCGGTCGGCGGATGAGCCCATGACCACGTTTTA
CAAGTGCTGCAACCACGAGTGCAACCACACCTGGCGAGACGCAAGCTTTC
TAGACCAT

BO35158.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG33785-RA 327 CG33785-PA 1..324 17..340 1605 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG33785-RA 1245 CG33785-RA 62..385 17..340 1605 99.7 Plus
CG33786-RA 1245 CG33786-RA 62..385 17..340 1605 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20643326..20643510 340..156 925 100 Minus
2R 25286936 2R 20643583..20643724 158..17 695 99.3 Minus
Blast to na_te.dros performed on 2014-11-28 14:40:46 has no hits.

BO35158.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:00:33 Download gff for BO35158.complete
Subject Subject Range Query Range Percent Splice Strand
CG33785-RA 75..385 30..342 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:20:04 Download gff for BO35158.complete
Subject Subject Range Query Range Percent Splice Strand
CG33786-RA 75..385 30..342 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:20:04 Download gff for BO35158.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20643324..20643508 158..342 98 <- Minus
2R 20643584..20643711 30..157 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:00:33 Download gff for BO35158.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16530829..16531013 158..342 98 <- Minus
arm_2R 16531089..16531216 30..157 99   Minus

BO35158.pep Sequence

Translation from 16 to 358

> BO35158.pep
MLFFCPSCGNILIIEEDTNCHRFTCNTCPYISKIRRKISTKTFPRLKEVD
HVLGGKAAWENVDSTDAECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNH
ECNHTWRDASFLDH

BO35158.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG33785-PA 108 CG33785-PA 1..108 1..108 621 100 Plus
RpII15-PC 129 CG3284-PC 20..129 4..108 157 30.9 Plus
RpII15-PB 129 CG3284-PB 20..129 4..108 157 30.9 Plus
RpII15-PA 129 CG3284-PA 20..129 4..108 157 30.9 Plus