Clone BO35173 Report

Search the DGRC for BO35173

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:351
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG42336-RB
Protein status:BO35173.pep: Imported from assembly
Sequenced Size:229

Clone Sequence Records

BO35173.complete Sequence

229 bp assembled on 2013-12-04

GenBank Submission: KX798645

> BO35173.complete
GAAGTTATCAGTCGACATGGTTGACCTCACCGACGCCGGCTCGCCGTTCC
AGCAATCCATTCCCGACTTCGCCTTCTACGTGCCGGCAATTGTTGTTTTT
ACCCTGGCAGCTCTCTTTGGCTACAAGCTGTACAAATCCCTGACGGAAAA
GGAGCTCAAGAAGCAGGAGAAACTGAAGAGCAAGCAACAGAAGAAGGCCA
AGAAGTCAAACGCAAGCTTTCTAGACCAT

BO35173.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-RB 198 CG42336-PB 1..195 17..211 975 100 Plus
CG42336-RD 489 CG42336-PD 383..486 108..211 520 100 Plus
CG42336-RF 423 CG42336-PF 319..420 110..211 510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-RB 509 CG42336-RB 164..360 15..211 985 100 Plus
CG42336-RD 707 CG42336-RD 455..558 108..211 520 100 Plus
CG42336-RF 901 CG42336-RF 651..752 110..211 510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11294685..11294788 211..108 520 100 Minus
2R 25286936 2R 11297262..11297357 110..15 480 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:41:55 has no hits.

BO35173.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:00:58 Download gff for BO35173.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 166..360 17..213 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:20:36 Download gff for BO35173.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RB 166..360 17..213 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:20:36 Download gff for BO35173.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294682..11294785 111..213 98 <- Minus
2R 11297262..11297355 17..110 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:00:58 Download gff for BO35173.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7184767..7184860 17..110 100   Minus
arm_2R 7182187..7182290 111..213 98 <- Minus

BO35173.pep Sequence

Translation from 16 to 229

> BO35173.pep
MVDLTDAGSPFQQSIPDFAFYVPAIVVFTLAALFGYKLYKSLTEKELKKQ
EKLKSKQQKKAKKSNASFLDH

BO35173.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-PB 65 CG13211-PA 1..65 1..65 324 100 Plus
CG42336-PF 140 CG42336-PF 83..140 8..65 184 67.2 Plus
CG42336-PE 140 CG42336-PE 83..140 8..65 184 67.2 Plus
CG42336-PD 162 CG42336-PD 125..162 28..65 174 92.1 Plus
CG42336-PC 138 CG13211-PB 92..138 22..65 170 78.7 Plus