Clone BO35188 Report

Search the DGRC for BO35188

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:351
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG42259-RA
Protein status:BO35188.pep: Imported from assembly
Sequenced Size:310

Clone Sequence Records

BO35188.complete Sequence

310 bp assembled on 2013-12-04

GenBank Submission: KX796773

> BO35188.complete
GAAGTTATCAGTCGACATGCTTCACTCAAACTATCTTTTTCTGATCGGCG
GTTGCTGCCTGGTTTTCGCTGTCTCAGCGCAGATTCCCATCACGCCGCGA
CGTTGCCCGGCGAACGAGACTTTCCTGGCCTGTGGTCCCGATTGTCAAAC
GGAGTGCGCCACGCTAGGAAAGCCCTGTCTGGTCAGGCACATCCGATGTC
CAGATGGATGCTACTGCAACAAGGGCTTCGCGAGGAACGCCGCGGGCACG
TGCATCCCCCTTCGGCGGTGCAACGAAGGCGGCTACGGAAACGCAAGCTT
TCTAGACCAT

BO35188.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG42259-RB 279 CG42259-PB 1..276 17..292 1380 100 Plus
CG42259-RA 279 CG42259-PA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG42259-RB 486 CG42259-RB 37..312 17..292 1380 100 Plus
CG42259-RA 711 CG42259-RA 262..537 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1046636..1046835 93..292 1000 100 Plus
X 23542271 X 1046485..1046560 17..92 380 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:42:18 has no hits.

BO35188.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:01:06 Download gff for BO35188.complete
Subject Subject Range Query Range Percent Splice Strand
CG42259-RA 262..537 17..294 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:20:44 Download gff for BO35188.complete
Subject Subject Range Query Range Percent Splice Strand
CG42259-RA 262..537 17..294 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:20:44 Download gff for BO35188.complete
Subject Subject Range Query Range Percent Splice Strand
X 1046485..1046560 17..92 100 -> Plus
X 1046636..1046835 93..294 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:01:06 Download gff for BO35188.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 940518..940593 17..92 100 -> Plus
arm_X 940669..940868 93..294 99   Plus

BO35188.pep Sequence

Translation from 16 to 310

> BO35188.pep
MLHSNYLFLIGGCCLVFAVSAQIPITPRRCPANETFLACGPDCQTECATL
GKPCLVRHIRCPDGCYCNKGFARNAAGTCIPLRRCNEGGYGNASFLDH

BO35188.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42259-PB 92 CG42259-PB 1..92 1..92 530 100 Plus
CG42259-PA 92 CG42259-PA 1..92 1..92 530 100 Plus