BO35195.complete Sequence
166 bp assembled on 2013-12-04
GenBank Submission: KX799701
> BO35195.complete
GAAGTTATCAGTCGACATGGTGTGGGATACTCAAGAGTGTAGCAATCAAG
ATGAGGATTTTGAACGGCCCAGCAGGACCCTGATTCTGGTAATCTTCACC
CTCGCCGTGTGCCTCAAGTTGTTCATCATTCTGCTGGAGATTATGTCCGC
AAGCTTTCTAGACCAT
BO35195.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:38:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43188-RA | 135 | CG43188-PA | 1..132 | 17..148 | 660 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43188-RA | 795 | CG43188-RA | 53..184 | 17..148 | 660 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11085638..11085769 | 17..148 | 660 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:38:21 has no hits.
BO35195.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:39 Download gff for
BO35195.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43188-RA | 53..184 | 17..150 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:19:04 Download gff for
BO35195.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43188-RA | 53..184 | 17..150 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:04 Download gff for
BO35195.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11085638..11085769 | 17..150 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:39 Download gff for
BO35195.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6973143..6973274 | 17..150 | 98 | | Plus |
BO35195.pep Sequence
Translation from 16 to 166
> BO35195.pep
MVWDTQECSNQDEDFERPSRTLILVIFTLAVCLKLFIILLEIMSASFLDH
BO35195.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:48:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43188-PA | 44 | CG43188-PA | 1..44 | 1..44 | 224 | 100 | Plus |