Clone BO35195 Report

Search the DGRC for BO35195

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:351
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG43188-RA
Protein status:BO35195.pep: Imported from assembly
Sequenced Size:166

Clone Sequence Records

BO35195.complete Sequence

166 bp assembled on 2013-12-04

GenBank Submission: KX799701

> BO35195.complete
GAAGTTATCAGTCGACATGGTGTGGGATACTCAAGAGTGTAGCAATCAAG
ATGAGGATTTTGAACGGCCCAGCAGGACCCTGATTCTGGTAATCTTCACC
CTCGCCGTGTGCCTCAAGTTGTTCATCATTCTGCTGGAGATTATGTCCGC
AAGCTTTCTAGACCAT

BO35195.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG43188-RA 135 CG43188-PA 1..132 17..148 660 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG43188-RA 795 CG43188-RA 53..184 17..148 660 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11085638..11085769 17..148 660 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:38:21 has no hits.

BO35195.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 09:59:39 Download gff for BO35195.complete
Subject Subject Range Query Range Percent Splice Strand
CG43188-RA 53..184 17..150 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:19:04 Download gff for BO35195.complete
Subject Subject Range Query Range Percent Splice Strand
CG43188-RA 53..184 17..150 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:19:04 Download gff for BO35195.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11085638..11085769 17..150 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 09:59:39 Download gff for BO35195.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6973143..6973274 17..150 98   Plus

BO35195.pep Sequence

Translation from 16 to 166

> BO35195.pep
MVWDTQECSNQDEDFERPSRTLILVIFTLAVCLKLFIILLEIMSASFLDH

BO35195.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG43188-PA 44 CG43188-PA 1..44 1..44 224 100 Plus