Clone BO35257 Report

Search the DGRC for BO35257

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:352
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG44476-RA
Protein status:BO35257.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO35257.complete Sequence

265 bp assembled on 2013-12-04

GenBank Submission: KX795537

> BO35257.complete
GAAGTTATCAGTCGACATGGGTGAAGAAAAAGATGTCTTATTGGATAGAG
ATAGTTGCACCCTCAACGGAGTGGACCAAGAACAAACCGATGCGATTCAT
AACGACTCTAATATGGAAATATTAACTGAGGAAGACTCAAGGCCATATAC
TTTTTTGCAAAACTTTAATTTCGTTGGCTTATGTGTTCTTTATAATTTTT
GCATGCTTTTAATTGTTCTGTCCATATACATCTACAAACGATGGAATGCA
AGCTTTCTAGACCAT

BO35257.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG44476-RA 234 CG44476-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG44476-RA 290 CG44476-RA 45..275 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18112845..18113071 247..21 1135 100 Minus
Blast to na_te.dros performed 2014-11-28 14:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1344..1391 216..169 105 68.8 Minus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6325..6352 203..230 104 85.7 Plus

BO35257.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:01:15 Download gff for BO35257.complete
Subject Subject Range Query Range Percent Splice Strand
CG44476-RA 45..275 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:20:53 Download gff for BO35257.complete
Subject Subject Range Query Range Percent Splice Strand
CG44476-RA 45..275 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:20:53 Download gff for BO35257.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18112843..18113072 17..249 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:01:15 Download gff for BO35257.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18112843..18113072 17..249 97   Minus

BO35257.pep Sequence

Translation from 16 to 265

> BO35257.pep
MGEEKDVLLDRDSCTLNGVDQEQTDAIHNDSNMEILTEEDSRPYTFLQNF
NFVGLCVLYNFCMLLIVLSIYIYKRWNASFLDH

BO35257.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG44476-PA 77 CG44476-PA 1..77 1..77 412 100 Plus