BO35257.complete Sequence
265 bp assembled on 2013-12-04
GenBank Submission: KX795537
> BO35257.complete
GAAGTTATCAGTCGACATGGGTGAAGAAAAAGATGTCTTATTGGATAGAG
ATAGTTGCACCCTCAACGGAGTGGACCAAGAACAAACCGATGCGATTCAT
AACGACTCTAATATGGAAATATTAACTGAGGAAGACTCAAGGCCATATAC
TTTTTTGCAAAACTTTAATTTCGTTGGCTTATGTGTTCTTTATAATTTTT
GCATGCTTTTAATTGTTCTGTCCATATACATCTACAAACGATGGAATGCA
AGCTTTCTAGACCAT
BO35257.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:42:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44476-RA | 234 | CG44476-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:42:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44476-RA | 290 | CG44476-RA | 45..275 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:42:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18112845..18113071 | 247..21 | 1135 | 100 | Minus |
Blast to na_te.dros performed 2014-11-28 14:42:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 1344..1391 | 216..169 | 105 | 68.8 | Minus |
Quasimodo | 7387 | Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. | 6325..6352 | 203..230 | 104 | 85.7 | Plus |
BO35257.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-12-04 10:01:15 Download gff for
BO35257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44476-RA | 45..275 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:20:53 Download gff for
BO35257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44476-RA | 45..275 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:20:53 Download gff for
BO35257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18112843..18113072 | 17..249 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-12-04 10:01:15 Download gff for
BO35257.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18112843..18113072 | 17..249 | 97 | | Minus |
BO35257.pep Sequence
Translation from 16 to 265
> BO35257.pep
MGEEKDVLLDRDSCTLNGVDQEQTDAIHNDSNMEILTEEDSRPYTFLQNF
NFVGLCVLYNFCMLLIVLSIYIYKRWNASFLDH
BO35257.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:49:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44476-PA | 77 | CG44476-PA | 1..77 | 1..77 | 412 | 100 | Plus |