Clone BO35463 Report

Search the DGRC for BO35463

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:354
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptBG642312-RA
Protein status:BO35463.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO35463.complete Sequence

265 bp assembled on 2015-03-10

GenBank Submission: KX798392

> BO35463.complete
GAAGTTATCAGTCGACATGCCCATCAATCGAATCAATCCCAGCACAGCCA
TGAGAAGCGCGTCGCTTAAGTTCTATCTGATATGTCTGCTAGTTATCTGC
GTGATCGGTTGGAGTGCTGGAGCACCGAGTCCGCAACTTTCACGTAAGGA
ACTCGAGGATCGATATCGACAAAAGCCCCCGGTGCCTGATGAGCGAGATG
CGGATGCAGAATTGGATAGTGCCTACGATCGGAATACCCGAAGACCTGCA
AGCTTTCTAGACCAT

BO35463.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
BG642312-RB 234 CG33943-PB 1..231 17..247 1155 100 Plus
BG642312-RA 234 CG33943-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
BG642312-RB 503 CG33943-RB 115..345 17..247 1155 100 Plus
BG642312-RA 540 CG33943-RA 152..382 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6232627..6232773 247..101 735 100 Minus
3L 28110227 3L 6232837..6232921 101..17 425 100 Minus
Blast to na_te.dros performed on 2015-03-10 14:06:51 has no hits.

BO35463.complete Sim4 Records

Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:10:30 Download gff for BO35463.complete
Subject Subject Range Query Range Percent Splice Strand
BG642312-RB 115..345 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:10:30 Download gff for BO35463.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6232624..6232772 102..249 98 <- Minus
3L 6232837..6232921 17..101 100   Minus

BO35463.pep Sequence

Translation from 16 to 265

> BO35463.pep
MPINRINPSTAMRSASLKFYLICLLVICVIGWSAGAPSPQLSRKELEDRY
RQKPPVPDERDADAELDSAYDRNTRRPASFLDH

BO35463.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
BG642312-PB 77 CG33943-PB 1..77 1..77 404 100 Plus
BG642312-PA 77 CG33943-PA 1..77 1..77 404 100 Plus