Clone BO35476 Report

Search the DGRC for BO35476

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:354
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCG44355-RA
Protein status:BO35476.pep: Imported from assembly
Sequenced Size:202

Clone Sequence Records

BO35476.complete Sequence

202 bp assembled on 2015-03-10

GenBank Submission: KX798019

> BO35476.complete
GAAGTTATCAGTCGACATGGCCTTCATGACTGCTGACTGCTCTCGTCTTG
TCTGTGACTCTTATGGCCCTGTTTTGTATGTTTGTGGAGCTGCGTTCTGC
TACGCATTCCGTTGGTATTCTACCATTAATACTTGTCTACTTAACGGTAA
ATTACAGACATTAAACGCACGCACACACGCACACGCAAGCTTTCTAGACC
AT

BO35476.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG44355-RA 171 CG44355-PA 1..168 17..184 840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG44355-RA 977 CG44355-RA 130..298 16..184 845 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12311046..12311214 16..184 845 100 Plus
Blast to na_te.dros performed 2015-03-10 14:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 611..664 99..46 99 64.8 Minus

BO35476.complete Sim4 Records

Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:10:36 Download gff for BO35476.complete
Subject Subject Range Query Range Percent Splice Strand
CG44355-RA 131..298 17..186 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:10:36 Download gff for BO35476.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12311047..12311214 17..186 98   Plus

BO35476.pep Sequence

Translation from 16 to 202

> BO35476.pep
MAFMTADCSRLVCDSYGPVLYVCGAAFCYAFRWYSTINTCLLNGKLQTLN
ARTHAHASFLDH

BO35476.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG44355-PA 56 CG44355-PA 1..56 1..56 313 100 Plus