Clone BO35479 Report

Search the DGRC for BO35479

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:354
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG43277-RA
Protein status:BO35479.pep: Imported from assembly
Sequenced Size:184

Clone Sequence Records

BO35479.complete Sequence

184 bp assembled on 2015-03-10

GenBank Submission: KX798241

> BO35479.complete
GAAGTTATCAGTCGACATGTCACCTTGGTCACAGCTGAAACCGATGGAGT
GGTGTAAGGCCGTTTACAGGGACTATCATTCCTGGTCATTCGTCAAGTGT
TCCCTGGCATTCTGTGCCGGTGTCCTCCTGGTCCGAAGCCTCGATGGAAA
GTTGCCGGCCAGCAGCGCAAGCTTTCTAGACCAT

BO35479.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG43277-RA 153 CG43277-PA 1..150 17..166 750 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG43277-RA 415 CG43277-RA 91..240 17..166 750 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19637717..19637866 17..166 750 100 Plus
Blast to na_te.dros performed on 2015-03-10 14:07:11 has no hits.

BO35479.complete Sim4 Records

Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:10:43 Download gff for BO35479.complete
Subject Subject Range Query Range Percent Splice Strand
CG43277-RA 91..240 17..168 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:10:43 Download gff for BO35479.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19637717..19637866 17..168 98   Plus

BO35479.pep Sequence

Translation from 16 to 184

> BO35479.pep
MSPWSQLKPMEWCKAVYRDYHSWSFVKCSLAFCAGVLLVRSLDGKLPASS
ASFLDH

BO35479.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG43277-PA 50 CG43277-PA 1..50 1..50 277 100 Plus