Clone BO35487 Report

Search the DGRC for BO35487

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:354
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptCG33293-RA
Protein status:BO35487.pep: Imported from assembly
Sequenced Size:292

Clone Sequence Records

BO35487.complete Sequence

292 bp assembled on 2015-03-10

GenBank Submission: KX800129

> BO35487.complete
GAAGTTATCAGTCGACATGGAACGATTCGCACTGACAACCTGCATTCGCC
GTGTCTGGATCATGTCCGGATGGCTGCGCCAGGAGGCGGCAATAGCAGCC
GGCATGTTGGTGGTGCAGCGACACCAGGTTGAGCTGAGGAATGAGGAGGA
GGAGGGGCTCAAAGTCGGACAGCAGACTGCATCCAGTGGCGGTGACGTGG
GCGTGGACTCGCAAGGAAGACTCCGCCGCGTGCGGCTGCTAGACGACTAC
ATTGTGCCCTTTGAATGCGGTCTTGCAAGCTTTCTAGACCAT

BO35487.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 261 CG33293-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 661 CG33293-RA 111..368 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5240307..5240564 274..17 1290 100 Minus
Blast to na_te.dros performed on 2015-03-10 14:07:16 has no hits.

BO35487.complete Sim4 Records

Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:10:47 Download gff for BO35487.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 111..368 17..276 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:10:47 Download gff for BO35487.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5240304..5240564 17..276 99   Minus

BO35487.pep Sequence

Translation from 16 to 292

> BO35487.pep
MERFALTTCIRRVWIMSGWLRQEAAIAAGMLVVQRHQVELRNEEEEGLKV
GQQTASSGGDVGVDSQGRLRRVRLLDDYIVPFECGLASFLDH

BO35487.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-PA 86 CG33293-PA 1..86 1..86 441 100 Plus