Clone BO35492 Report

Search the DGRC for BO35492

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:354
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptCG17376-RA
Protein status:BO35492.pep: Imported from assembly
Sequenced Size:169

Clone Sequence Records

BO35492.complete Sequence

169 bp assembled on 2015-03-10

GenBank Submission: KX796363

> BO35492.complete
GAAGTTATCAGTCGACATGTGCAACGGATGTGGATGCTGTGGACCCTCTC
CTTGCCCCAGGCGTTACCTTGTTAACAAGGATAACGCGCCTTGCGTGTGG
TGTGCTCCGTGCAAAGCCCACTGCTACAACACTCCGCCAAAATGCTGTTG
CGCAAGCTTTCTAGACCAT

BO35492.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG17376-RA 138 CG17376-PA 1..135 17..151 675 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17376-RA 449 CG17376-RA 98..234 15..151 685 100 Plus
CG17376-RC 784 CG17376-RC 466..569 48..151 520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6800212..6800315 151..48 520 100 Minus
Blast to na_te.dros performed on 2015-03-10 14:07:18 has no hits.

BO35492.complete Sim4 Records

Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:10:49 Download gff for BO35492.complete
Subject Subject Range Query Range Percent Splice Strand
CG17376-RA 100..234 17..153 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:10:49 Download gff for BO35492.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6800651..6800681 17..47 100   Minus
2L 6800210..6800315 48..153 98 <- Minus

BO35492.pep Sequence

Translation from 16 to 169

> BO35492.pep
MCNGCGCCGPSPCPRRYLVNKDNAPCVWCAPCKAHCYNTPPKCCCASFLD
H

BO35492.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG17376-PA 45 CG17376-PA 1..45 1..45 301 100 Plus