BO35492.complete Sequence
169 bp assembled on 2015-03-10
GenBank Submission: KX796363
> BO35492.complete
GAAGTTATCAGTCGACATGTGCAACGGATGTGGATGCTGTGGACCCTCTC
CTTGCCCCAGGCGTTACCTTGTTAACAAGGATAACGCGCCTTGCGTGTGG
TGTGCTCCGTGCAAAGCCCACTGCTACAACACTCCGCCAAAATGCTGTTG
CGCAAGCTTTCTAGACCAT
BO35492.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:07:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17376-RA | 138 | CG17376-PA | 1..135 | 17..151 | 675 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:07:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17376-RA | 449 | CG17376-RA | 98..234 | 15..151 | 685 | 100 | Plus |
CG17376-RC | 784 | CG17376-RC | 466..569 | 48..151 | 520 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:07:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6800212..6800315 | 151..48 | 520 | 100 | Minus |
Blast to na_te.dros performed on 2015-03-10 14:07:18 has no hits.
BO35492.complete Sim4 Records
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:10:49 Download gff for
BO35492.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17376-RA | 100..234 | 17..153 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:10:49 Download gff for
BO35492.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6800651..6800681 | 17..47 | 100 | | Minus |
2L | 6800210..6800315 | 48..153 | 98 | <- | Minus |
BO35492.pep Sequence
Translation from 16 to 169
> BO35492.pep
MCNGCGCCGPSPCPRRYLVNKDNAPCVWCAPCKAHCYNTPPKCCCASFLD
H
BO35492.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:06:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17376-PA | 45 | CG17376-PA | 1..45 | 1..45 | 301 | 100 | Plus |