Clone BS01002 Report

Search the DGRC for BS01002

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:10
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptRpb10-RA
Protein status:BS01002.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS01002.3prime Sequence

236 bp (235 high quality bases) assembled on 2005-11-30

> BS01002.3prime
ATGGTCTAGAAAGCTTCGTCACTTCTCCAGAGGAGCATAGTTGAGCAGTT
TTTCGATAAGATCCACGTGGCCCAGGAGCATGCGACGGCAGCAGTACCTC
TTTAGACCCAAAGCATCCAGGGCATCTCCTTCGGTGTATTCCGCTTGCAG
GAGACCCAAATACGACTCCCACTTGTTGCCAATGACCTTGCCGCAGGTGA
AACAACGGATTGGAATAATCATGTCGACTGATAACT

BS01002.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13628-PA 204 Rpb10-RA 1..204 222..19 1020 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-RA 405 CG13628-RA 108..311 222..19 1020 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24717795..24717904 128..19 550 100 Minus
3R 32079331 3R 24717618..24717712 222..128 475 100 Minus
Blast to na_te.dros performed on 2015-02-10 17:05:07 has no hits.

BS01002.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:57:52 Download gff for BS01002.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-PA 1..204 19..222 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:04:03 Download gff for BS01002.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13628-PA 1..204 19..222 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 10:08:22 Download gff for BS01002.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..316 13..222 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:06:27 Download gff for BS01002.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..316 13..222 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:06:27 Download gff for BS01002.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 24717618..24717712 128..222 100 -> Minus
3R 24717796..24717909 13..127 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 10:08:22 Download gff for BS01002.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20543340..20543434 128..222 100 -> Minus
arm_3R 20543518..20543631 13..127 97   Minus

BS01002.5prime Sequence

236 bp (235 high quality bases) assembled on 2005-11-30

> BS01002.5prime
GAAGTTATCAGTCGACATGATTATTCCAATCCGTTGTTTCACCTGCGGCA
AGGTCATTGGCAACAAGTGGGAGTCGTATTTGGGTCTCCTGCAAGCGGAA
TACACCGAAGGAGATGCCCTGGATGCTTTGGGTCTAAAGAGGTACTGCTG
CCGTCGCATGCTCCTGGGCCACGTGGATCTTATCGAAAAACTGCTCAACT
ATGCTCCTCTGGAGAAGTGACGAAGCTTTCTAGACC

BS01002.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13628-PA 204 Rpb10-RA 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-RA 405 CG13628-RA 108..311 17..220 1020 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24717795..24717904 111..220 550 100 Plus
3R 32079331 3R 24717618..24717712 17..111 475 100 Plus
Blast to na_te.dros performed on 2015-02-11 10:08:22 has no hits.

BS01002.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:57:53 Download gff for BS01002.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-PA 1..204 17..220 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:04:04 Download gff for BS01002.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13628-PA 1..204 17..220 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 02:41:24 Download gff for BS01002.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..316 17..226 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:10:43 Download gff for BS01002.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..316 17..226 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:10:43 Download gff for BS01002.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 24717618..24717712 17..111 100 -> Plus
3R 24717796..24717909 112..226 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 02:41:24 Download gff for BS01002.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20543340..20543434 17..111 100 -> Plus
arm_3R 20543518..20543631 112..226 97   Plus

BS01002.complete Sequence

238 bp assembled on 2007-10-17

GenBank Submission: FJ634489

> BS01002.complete
GAAGTTATCAGTCGACATGATTATTCCAATCCGTTGTTTCACCTGCGGCA
AGGTCATTGGCAACAAGTGGGAGTCGTATTTGGGTCTCCTGCAAGCGGAA
TACACCGAAGGAGATGCCCTGGATGCTTTGGGTCTAAAGAGGTACTGCTG
CCGTCGCATGCTCCTGGGCCACGTGGATCTTATCGAAAAACTGCTCAACT
ATGCTCCTCTGGAGAAGTGACGAAGCTTTCTAGACCAT

BS01002.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-RA 204 CG13628-PA 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-RA 405 CG13628-RA 108..311 17..220 1020 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24717795..24717904 111..220 550 100 Plus
3R 32079331 3R 24717618..24717712 17..111 475 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:22:47 has no hits.

BS01002.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:42:28 Download gff for BS01002.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..204 17..220 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:16:05 Download gff for BS01002.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 65..273 17..226 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:23:28 Download gff for BS01002.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..314 17..222 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:43:19 Download gff for BS01002.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 65..271 17..222 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:30:49 Download gff for BS01002.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 108..314 17..222 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:30:49 Download gff for BS01002.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24717618..24717712 17..111 100 -> Plus
3R 24717796..24717907 112..222 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:23:28 Download gff for BS01002.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20543340..20543434 17..111 100 -> Plus
arm_3R 20543518..20543629 112..222 99   Plus

BS01002.pep Sequence

Translation from 16 to 219

> BS01002.pep
MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLL
GHVDLIEKLLNYAPLEK*

BS01002.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-PA 67 CG13628-PA 1..67 1..67 360 100 Plus