Clone Sequence Records
BS01002.3prime Sequence
236 bp (235 high quality bases) assembled on 2005-11-30
> BS01002.3prime
ATGGTCTAGAAAGCTTCGTCACTTCTCCAGAGGAGCATAGTTGAGCAGTT
TTTCGATAAGATCCACGTGGCCCAGGAGCATGCGACGGCAGCAGTACCTC
TTTAGACCCAAAGCATCCAGGGCATCTCCTTCGGTGTATTCCGCTTGCAG
GAGACCCAAATACGACTCCCACTTGTTGCCAATGACCTTGCCGCAGGTGA
AACAACGGATTGGAATAATCATGTCGACTGATAACT
BS01002.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:43:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13628-PA | 204 | Rpb10-RA | 1..204 | 222..19 | 1020 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:05:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rpb10-RA | 405 | CG13628-RA | 108..311 | 222..19 | 1020 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:05:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 24717795..24717904 | 128..19 | 550 | 100 | Minus |
3R | 32079331 | 3R | 24717618..24717712 | 222..128 | 475 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 17:05:07 has no hits.
BS01002.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:57:52 Download gff for
BS01002.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-PA | 1..204 | 19..222 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:04:03 Download gff for
BS01002.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13628-PA | 1..204 | 19..222 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 10:08:22 Download gff for
BS01002.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-RA | 108..316 | 13..222 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:06:27 Download gff for
BS01002.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-RA | 108..316 | 13..222 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:06:27 Download gff for
BS01002.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24717618..24717712 | 128..222 | 100 | -> | Minus |
3R | 24717796..24717909 | 13..127 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 10:08:22 Download gff for
BS01002.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 20543340..20543434 | 128..222 | 100 | -> | Minus |
arm_3R | 20543518..20543631 | 13..127 | 97 | | Minus |
BS01002.5prime Sequence
236 bp (235 high quality bases) assembled on 2005-11-30
> BS01002.5prime
GAAGTTATCAGTCGACATGATTATTCCAATCCGTTGTTTCACCTGCGGCA
AGGTCATTGGCAACAAGTGGGAGTCGTATTTGGGTCTCCTGCAAGCGGAA
TACACCGAAGGAGATGCCCTGGATGCTTTGGGTCTAAAGAGGTACTGCTG
CCGTCGCATGCTCCTGGGCCACGTGGATCTTATCGAAAAACTGCTCAACT
ATGCTCCTCTGGAGAAGTGACGAAGCTTTCTAGACC
BS01002.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:43:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13628-PA | 204 | Rpb10-RA | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:08:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rpb10-RA | 405 | CG13628-RA | 108..311 | 17..220 | 1020 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:08:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 24717795..24717904 | 111..220 | 550 | 100 | Plus |
3R | 32079331 | 3R | 24717618..24717712 | 17..111 | 475 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 10:08:22 has no hits.
BS01002.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:57:53 Download gff for
BS01002.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-PA | 1..204 | 17..220 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:04:04 Download gff for
BS01002.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13628-PA | 1..204 | 17..220 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 02:41:24 Download gff for
BS01002.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-RA | 108..316 | 17..226 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:10:43 Download gff for
BS01002.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-RA | 108..316 | 17..226 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:10:43 Download gff for
BS01002.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24717618..24717712 | 17..111 | 100 | -> | Plus |
3R | 24717796..24717909 | 112..226 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 02:41:24 Download gff for
BS01002.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 20543340..20543434 | 17..111 | 100 | -> | Plus |
arm_3R | 20543518..20543631 | 112..226 | 97 | | Plus |
BS01002.complete Sequence
238 bp assembled on 2007-10-17
GenBank Submission: FJ634489
> BS01002.complete
GAAGTTATCAGTCGACATGATTATTCCAATCCGTTGTTTCACCTGCGGCA
AGGTCATTGGCAACAAGTGGGAGTCGTATTTGGGTCTCCTGCAAGCGGAA
TACACCGAAGGAGATGCCCTGGATGCTTTGGGTCTAAAGAGGTACTGCTG
CCGTCGCATGCTCCTGGGCCACGTGGATCTTATCGAAAAACTGCTCAACT
ATGCTCCTCTGGAGAAGTGACGAAGCTTTCTAGACCAT
BS01002.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:22:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rpb10-RA | 204 | CG13628-PA | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:22:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rpb10-RA | 405 | CG13628-RA | 108..311 | 17..220 | 1020 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:22:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 24717795..24717904 | 111..220 | 550 | 100 | Plus |
3R | 32079331 | 3R | 24717618..24717712 | 17..111 | 475 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 00:22:47 has no hits.
BS01002.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:42:28 Download gff for
BS01002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-RA | 1..204 | 17..220 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:16:05 Download gff for
BS01002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-RA | 65..273 | 17..226 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:23:28 Download gff for
BS01002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-RA | 108..314 | 17..222 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:43:19 Download gff for
BS01002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-RA | 65..271 | 17..222 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:30:49 Download gff for
BS01002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Rpb10-RA | 108..314 | 17..222 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:30:49 Download gff for
BS01002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24717618..24717712 | 17..111 | 100 | -> | Plus |
3R | 24717796..24717907 | 112..222 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:23:28 Download gff for
BS01002.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 20543340..20543434 | 17..111 | 100 | -> | Plus |
arm_3R | 20543518..20543629 | 112..222 | 99 | | Plus |
BS01002.pep Sequence
Translation from 16 to 219
> BS01002.pep
MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLL
GHVDLIEKLLNYAPLEK*
BS01002.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:35:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rpb10-PA | 67 | CG13628-PA | 1..67 | 1..67 | 360 | 100 | Plus |