Clone BS03049 Report

Search the DGRC for BS03049

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:30
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG13315-RA
Protein status:BS03049.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS03049.5prime Sequence

240 bp (239 high quality bases) assembled on 2005-11-29

> BS03049.5prime
GAAGTTATCAGTCGACATGTCTGCCACTAAGGTGAACCATTTGATCGGAG
CGACTACGCGCTACATTGCCGGACGGAATGCGGTGCAGACGGTCTACTGG
CGCACCTCAGCCGGACCCAATCCCCGGATGCTGAAGACCAACAAGCTGCA
GAACTTCGATCGCACCCAGAAGGCGCCTCAGAGTGTACGGATGCAGAACT
ATGATCGCAGCTATATCCGTGATTAGAAGCTTTCTAGACC

BS03049.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-PA 210 CG13315-RA 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-RB 498 CG13315-RB 135..344 17..226 1050 100 Plus
CG13315-RA 618 CG13315-RA 135..344 17..226 1050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9097011..9097220 17..226 1050 100 Plus
Blast to na_te.dros performed on 2015-02-11 10:19:02 has no hits.

BS03049.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:20:31 Download gff for BS03049.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-PA 1..210 17..226 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:33:27 Download gff for BS03049.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-PA 1..210 17..226 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 02:45:23 Download gff for BS03049.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..349 17..232 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:14:36 Download gff for BS03049.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..349 17..232 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:14:36 Download gff for BS03049.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 9097011..9097225 17..232 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 02:45:23 Download gff for BS03049.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9090111..9090325 17..232 98   Plus

BS03049.3prime Sequence

240 bp (239 high quality bases) assembled on 2005-11-30

> BS03049.3prime
ATGGTCTAGAAAGCTTCTAATCACGGATATAGCTGCGATCATAGTTCTGC
ATCCGTACACTCTGAGGCGCCTTCTGGGTGCGATCGAAGTTCTGCAGCTT
GTTGGTCTTCAGCATCCGGGGATTGGGTCCGGCTGAGGTGCGCCAGTAGA
CCGTCTGCACCGCATTCCGTCCGGCAATGTAGCGCGTAGTCGCTCCGATC
AAATGGTTCACCTTAGTGGCAGACATGTCGACTGATAACT

BS03049.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-PA 210 CG13315-RA 1..210 226..17 1050 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-RB 498 CG13315-RB 135..344 226..17 1050 100 Minus
CG13315-RA 618 CG13315-RA 135..344 226..17 1050 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 11:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9097011..9097220 226..17 1050 100 Minus
Blast to na_te.dros performed on 2015-02-11 11:16:24 has no hits.

BS03049.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:20:30 Download gff for BS03049.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-PA 1..210 17..226 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:33:26 Download gff for BS03049.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-PA 1..210 17..226 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 08:12:40 Download gff for BS03049.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..349 11..226 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:50:26 Download gff for BS03049.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..349 11..226 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:50:26 Download gff for BS03049.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 9097011..9097225 11..226 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 08:12:40 Download gff for BS03049.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9090111..9090325 11..226 98   Minus

BS03049.complete Sequence

242 bp (242 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ638768

> BS03049.complete
GAAGTTATCAGTCGACATGTCTGCCACTAAGGTGAACCATTTGATCGGAG
CGACTACGCGCTACATTGCCGGACGGAATGCGGTGCAGACGGTCTACTGG
CGCACCTCAGCCGGACCCAATCCCCGGATGCTGAAGACCAACAAGCTGCA
GAACTTCGATCGCACCCAGAAGGCGCCTCAGAGTGTACGGATGCAGAACT
ATGATCGCAGCTATATCCGTGATTAGAAGCTTTCTAGACCAT

BS03049.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-RB 210 CG13315-PB 1..210 17..226 1050 100 Plus
CG13315-RA 210 CG13315-PA 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-RB 498 CG13315-RB 135..344 17..226 1050 100 Plus
CG13315-RA 618 CG13315-RA 135..344 17..226 1050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9097011..9097220 17..226 1050 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:06:28 has no hits.

BS03049.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:34:08 Download gff for BS03049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 1..210 17..226 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:58:23 Download gff for BS03049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 136..350 17..232 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:49:16 Download gff for BS03049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..344 17..226 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:34:08 Download gff for BS03049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 136..350 17..232 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:10:44 Download gff for BS03049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13315-RA 135..344 17..226 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:10:44 Download gff for BS03049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9097011..9097220 17..226 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:49:16 Download gff for BS03049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9090111..9090320 17..226 100   Plus

BS03049.pep Sequence

Translation from 16 to 225

> BS03049.pep
MSATKVNHLIGATTRYIAGRNAVQTVYWRTSAGPNPRMLKTNKLQNFDRT
QKAPQSVRMQNYDRSYIRD*

BS03049.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13315-PB 69 CG13315-PB 1..69 1..69 361 100 Plus
CG13315-PA 69 CG13315-PA 1..69 1..69 361 100 Plus