Clone BS03371 Report

Search the DGRC for BS03371

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:33
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptRoc1a-RA
Protein status:BS03371.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS03371.3prime Sequence

357 bp (356 high quality bases) assembled on 2005-11-30

> BS03371.3prime
ATGGTCTAGAAAGCTTTTAGTGGCCGTACTTCTGGAAATCCCACTCGCGG
TTGTCCAGTGGGCATACCTGGCGCGTCTTTAGCCAGCGAGAGATGCAGTG
GAAATGGAAGGCGTGGTTGCAGACGCCCCAGGCCACGGTGCACTCCTCGC
TAGTGGCGGACGCCTGGTTCGCCTGACACTCGATGCACAAGTCCATGATG
TGGTTGCGGCAGATGGCGCAGTTGTCCACCACGATGTCCCAGGCCCACAG
AGCCACGGCGTTCCACTTCTTCACCTCAAAGCGCTTCTTATCGCCCTTGC
TGCTGCTGGAGGGAACCTCGTATCCATCCTCGTCGACTTCCATGTCGACT
GATAACT

BS03371.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG16982-PA 327 Roc1a-RA 1..327 343..17 1635 100 Minus
CG16988-PA 369 Roc1b-RA 160..219 229..170 175 91.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:53:39
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-RD 1145 CG16982-RD 144..473 344..15 1650 100 Minus
Roc1a-RA 696 CG16982-RA 144..473 344..15 1650 100 Minus
Roc1a-RC 1229 CG16982-RC 305..557 267..15 1265 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 647702..647925 238..15 1120 100 Minus
3L 28110227 3L 358134..358398 285..18 435 78.4 Minus
X 23542271 X 647447..647525 344..266 395 100 Minus
Blast to na_te.dros performed 2015-02-10 15:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2227..2273 239..195 104 72.3 Minus

BS03371.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:24:42 Download gff for BS03371.3prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-PA 1..327 17..343 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:38:57 Download gff for BS03371.3prime
Subject Subject Range Query Range Percent Splice Strand
CG16982-PA 1..327 17..343 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-14 14:59:17 Download gff for BS03371.3prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 139..476 12..348 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:07:16 Download gff for BS03371.3prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 139..476 12..348 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:07:16 Download gff for BS03371.3prime
Subject Subject Range Query Range Percent Splice Strand
X 647442..647525 266..348 97 -> Minus
X 647610..647637 238..265 100 -> Minus
X 647703..647928 12..237 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-14 14:59:17 Download gff for BS03371.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 541475..541558 266..348 97 -> Minus
arm_X 541643..541670 238..265 100 -> Minus
arm_X 541736..541961 12..237 99   Minus

BS03371.5prime Sequence

349 bp (349 high quality bases) assembled on 2005-11-28

> BS03371.5prime
CAGTCGACATGGAAGTCGACGAGGATGGATACGAGGTTCCCTCCAGCAGC
AGCAAGGGCGATAAGAAGCGCTTTGAGGTGAAGAAGTGGAACGCCGTGGC
TCTGTGGGCCTGGGACATCGTGGTGGACAACTGCGCCATCTGCCGCAACC
ACATCATGGACTTGTGCATCGAGTGTCAGGCGAACCAGGCGTCCGCCACT
AGCGAGGAGTGCACCGTGGCCTGGGGCGTCTGCAACCACGCCTTCCATTT
CCACTGCATCTCTCGCTGGCTAAAGACGCGCCAGGTATGCCCACTGGACA
ACCGCGAGTGGGATTTCCAGAAGTACGGCCACTAAAAGCTTTCTAGACC

BS03371.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG16982-PA 327 Roc1a-RA 1..327 9..335 1635 100 Plus
CG16988-PA 369 Roc1b-RA 160..219 123..182 175 91.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-RD 1145 CG16982-RD 144..473 8..337 1650 100 Plus
Roc1a-RA 696 CG16982-RA 144..473 8..337 1650 100 Plus
Roc1a-RC 1229 CG16982-RC 305..557 85..337 1265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 647702..647925 114..337 1120 100 Plus
3L 28110227 3L 358134..358398 67..334 435 78.4 Plus
X 23542271 X 647447..647525 8..86 395 100 Plus
Blast to na_te.dros performed 2015-02-11 09:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2227..2273 113..157 104 72.3 Plus

BS03371.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:24:43 Download gff for BS03371.5prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-PA 1..327 9..335 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:38:58 Download gff for BS03371.5prime
Subject Subject Range Query Range Percent Splice Strand
CG16982-PA 1..327 9..335 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 02:49:39 Download gff for BS03371.5prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 141..476 1..340 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:04:21 Download gff for BS03371.5prime
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 141..476 1..340 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:04:21 Download gff for BS03371.5prime
Subject Subject Range Query Range Percent Splice Strand
X 647444..647525 1..86 95 -> Plus
X 647610..647637 87..114 100 -> Plus
X 647703..647928 115..340 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 02:49:39 Download gff for BS03371.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 541477..541558 1..86 95 -> Plus
arm_X 541643..541670 87..114 100 -> Plus
arm_X 541736..541961 115..340 99   Plus

BS03371.complete Sequence

359 bp (359 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ634718

> BS03371.complete
GAAGTTATCAGTCGACATGGAAGTCGACGAGGATGGATACGAGGTTCCCT
CCAGCAGCAGCAAGGGCGATAAGAAGCGCTTTGAGGTGAAGAAGTGGAAC
GCCGTGGCTCTGTGGGCCTGGGACATCGTGGTGGACAACTGCGCCATCTG
CCGCAACCACATCATGGACTTGTGCATCGAGTGTCAGGCGAACCAGGCGT
CCGCCACTAGCGAGGAGTGCACCGTGGCCTGGGGCGTCTGCAACCACGCC
TTCCATTTCCACTGCATCTCTCGCTGGCTAAAGACGCGCCAGGTATGCCC
ACTGGACAACCGCGAGTGGGATTTCCAGAAGTACGGCCACTAAAAGCTTT
CTAGACCAT

BS03371.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-RD 327 CG16982-PD 1..327 17..343 1635 100 Plus
Roc1a-RA 327 CG16982-PA 1..327 17..343 1635 100 Plus
Roc1a-RC 411 CG16982-PC 161..411 93..343 1255 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-RD 1145 CG16982-RD 144..473 16..345 1650 100 Plus
Roc1a-RA 696 CG16982-RA 144..473 16..345 1650 100 Plus
Roc1a-RC 1229 CG16982-RC 305..557 93..345 1265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:34:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 647702..647925 122..345 1120 100 Plus
3L 28110227 3L 358134..358398 75..342 435 78.4 Plus
X 23542271 X 647447..647525 16..94 395 100 Plus
Blast to na_te.dros performed 2014-11-27 13:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2227..2273 121..165 104 72.3 Plus

BS03371.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:33:54 Download gff for BS03371.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 1..327 17..343 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:58:19 Download gff for BS03371.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 156..493 12..348 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:50 Download gff for BS03371.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 145..469 17..341 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:33:55 Download gff for BS03371.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 156..493 12..348 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:50:58 Download gff for BS03371.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1a-RA 145..469 17..341 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:50:58 Download gff for BS03371.complete
Subject Subject Range Query Range Percent Splice Strand
X 647703..647921 123..341 100   Plus
X 647448..647525 17..94 100 -> Plus
X 647610..647637 95..122 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:50 Download gff for BS03371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 541481..541558 17..94 100 -> Plus
arm_X 541643..541670 95..122 100 -> Plus
arm_X 541736..541954 123..341 100   Plus

BS03371.pep Sequence

Translation from 16 to 342

> BS03371.pep
MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIM
DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
WDFQKYGH*

BS03371.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1a-PD 108 CG16982-PD 1..108 1..108 619 100 Plus
Roc1a-PA 108 CG16982-PA 1..108 1..108 619 100 Plus
Roc1a-PC 136 CG16982-PC 1..136 1..108 580 79.4 Plus
Roc1b-PA 122 CG16988-PA 21..121 9..107 395 67.6 Plus
Roc2-PB 113 CG8998-PB 6..112 5..107 274 43.9 Plus