Clone BS03637 Report

Search the DGRC for BS03637

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:36
Well:37
Vector:pDNR-Dual
Associated Gene/Transcriptolf186-F-RC
Protein status:BS03637.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS03637.3prime Sequence

429 bp (428 high quality bases) assembled on 2005-12-01

> BS03637.3prime
ATGGTCTAGAAAGCTTTCAAATTCGACAATCAATTTGAACGGTGCGGCCT
GCCTTCGCCTGGTTCTGTGAGGAAGGGGGCGGGGGCGGCGGGAACTGCAG
CAGCGAGTTGCTGATGCTGGTGCGCTGGAAACCTGCGCTGTTGTTGCTGT
TGCTGCCGCTACCCGTGGGACTGTTGCTGTGGTGCTGTGGATGCGGATGT
GCGTGCAGCGGGAACTGTTGCTGGAACTGATGACCGGTGGCCACTGAAGT
GGCGGCTGCAACGGCGGCGGCCACAACGTGCTGGAAGTGGTGCTGCTGGT
GATTTCCAGTGGTGATCACTGCAGAACTTCTCGCTGCCCGCGGAACCGAC
GACGTGATCGGCGACTTTGTTGGCGTCTCTAGGCCCGAATTGTTGGCCGT
GGTCCACACAGACATGTCGACTGATAACT

BS03637.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG11430-PC 399 olf186-F-RC 1..399 415..17 1995 100 Minus
CG11430-PB 1056 olf186-F-RB 1..363 415..53 1815 100 Minus
CG11430-PA 1056 olf186-F-RA 1..363 415..53 1815 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
olf186-F-RG 4582 CG11430-RG 236..636 416..16 2005 100 Minus
olf186-F-RF 2407 CG11430-RF 563..926 416..53 1820 100 Minus
olf186-F-RA 2080 CG11430-RA 236..599 416..53 1820 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17851097..17851461 416..52 1825 100 Minus
2R 25286936 2R 17855138..17855176 54..16 195 100 Minus
Blast to na_te.dros performed 2015-02-12 23:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6730..6958 305..74 253 60.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6952 337..111 247 59.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6887 258..107 205 63.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6862 232..105 203 65.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6838 220..95 199 66.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2314..2505 303..107 189 58.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..6819 200..96 183 71.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2427 232..107 179 65.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2417 211..95 176 67.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2424 223..107 164 61 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2747..2857 221..106 162 65 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2331..2460 232..107 154 62.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2382 182..107 145 70.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6788 160..107 143 80.4 Minus
roo 9092 roo DM_ROO 9092bp 1059..1155 231..136 140 61.9 Minus
roo 9092 roo DM_ROO 9092bp 1052..1148 198..107 137 67 Minus
roo 9092 roo DM_ROO 9092bp 1054..1154 211..107 137 64.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2588..2643 162..107 118 67.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2437..2668 338..106 117 55.4 Minus
roo 9092 roo DM_ROO 9092bp 1062..1115 160..107 116 75 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1518..1575 193..137 107 67.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2766..2835 179..107 106 64.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2593..2649 163..107 105 64.9 Minus

BS03637.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:28:55 Download gff for BS03637.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11430-PC 1..399 17..415 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:44:20 Download gff for BS03637.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11430-PC 1..399 17..415 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 16:55:05 Download gff for BS03637.3prime
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RG 236..636 16..416 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:15:51 Download gff for BS03637.3prime
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RG 236..636 16..416 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:15:51 Download gff for BS03637.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 17851097..17851460 53..416 100 -> Minus
2R 17855140..17855176 16..52 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 16:55:05 Download gff for BS03637.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13738602..13738965 53..416 100 -> Minus
arm_2R 13742645..13742681 16..52 100   Minus

BS03637.5prime Sequence

429 bp (428 high quality bases) assembled on 2005-12-01

> BS03637.5prime
GAAGTTATCAGTCGACATGTCTGTGTGGACCACGGCCAACAATTCGGGCC
TAGAGACGCCAACAAAGTCGCCGATCACGTCGTCGGTTCCGCGGGCAGCG
AGAAGTTCTGCAGTGATCACCACTGGAAATCACCAGCAGCACCACTTCCA
GCACGTTGTGGCCGCCGCCGTTGCAGCCGCCACTTCAGTGGCCACCGGTC
ATCAGTTCCAGCAACAGTTCCCGCTGCACGCACATCCGCATCCACAGCAC
CACAGCAACAGTCCCACGGGTAGCGGCAGCAACAGCAACAACAGCGCAGG
TTTCCAGCGCACCAGCATCAGCAACTCGCTGCTGCAGTTCCCGCCGCCCC
CGCCCCCTTCCTCACAGAACCAGGCGAAGGCAGGCCGCACCGTTCAAATT
GATTGTCGAATTTGAAAGCTTTCTAGACC

BS03637.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG11430-PC 399 olf186-F-RC 1..399 17..415 1995 100 Plus
CG11430-PB 1056 olf186-F-RB 1..363 17..379 1815 100 Plus
CG11430-PA 1056 olf186-F-RA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 01:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
olf186-F-RG 4582 CG11430-RG 236..636 16..416 2005 100 Plus
olf186-F-RF 2407 CG11430-RF 563..926 16..379 1820 100 Plus
olf186-F-RA 2080 CG11430-RA 236..599 16..379 1820 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 01:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17851097..17851461 16..380 1825 100 Plus
2R 25286936 2R 17855138..17855176 378..416 195 100 Plus
Blast to na_te.dros performed 2015-02-11 01:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6730..6958 127..358 253 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6952 95..321 247 59.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6887 174..325 205 63.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6862 200..327 203 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6838 212..337 199 66.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2314..2505 129..325 189 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..6819 232..336 183 71.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2427 200..325 179 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2417 221..337 176 67.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2424 209..325 164 61 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2747..2857 211..326 162 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2331..2460 200..325 154 62.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2382 250..325 145 70.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6788 272..325 143 80.4 Plus
roo 9092 roo DM_ROO 9092bp 1059..1155 201..296 140 61.9 Plus
roo 9092 roo DM_ROO 9092bp 1052..1148 234..325 137 67 Plus
roo 9092 roo DM_ROO 9092bp 1054..1154 221..325 137 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2588..2643 270..325 118 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2437..2668 94..326 117 55.4 Plus
roo 9092 roo DM_ROO 9092bp 1062..1115 272..325 116 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1518..1575 239..295 107 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2766..2835 253..325 106 64.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2593..2649 269..325 105 64.9 Plus

BS03637.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:28:56 Download gff for BS03637.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11430-PC 1..399 17..415 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:44:22 Download gff for BS03637.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11430-PC 1..399 17..415 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 15:11:21 Download gff for BS03637.5prime
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RG 236..636 16..416 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:30:42 Download gff for BS03637.5prime
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RG 236..636 16..416 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 04:30:42 Download gff for BS03637.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 17851097..17851460 16..379 100 -> Plus
2R 17855140..17855176 380..416 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 15:11:21 Download gff for BS03637.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13738602..13738965 16..379 100 -> Plus
arm_2R 13742645..13742681 380..416 100   Plus

BS03637.complete Sequence

431 bp (431 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ634733

> BS03637.complete
GAAGTTATCAGTCGACATGTCTGTGTGGACCACGGCCAACAATTCGGGCC
TAGAGACGCCAACAAAGTCGCCGATCACGTCGTCGGTTCCGCGGGCAGCG
AGAAGTTCTGCAGTGATCACCACTGGAAATCACCAGCAGCACCACTTCCA
GCACGTTGTGGCCGCCGCCGTTGCAGCCGCCACTTCAGTGGCCACCGGTC
ATCAGTTCCAGCAACAGTTCCCGCTGCACGCACATCCGCATCCACAGCAC
CACAGCAACAGTCCCACGGGTAGCGGCAGCAACAGCAACAACAGCGCAGG
TTTCCAGCGCACCAGCATCAGCAACTCGCTGCTGCAGTTCCCGCCGCCCC
CGCCCCCTTCCTCACAGAACCAGGCGAAGGCAGGCCGCACCGTTCAAATT
GATTGTCGAATTTGAAAGCTTTCTAGACCAT

BS03637.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
olf186-F-RF 1056 CG11430-PF 1..363 17..379 1815 100 Plus
olf186-F-RA 1056 CG11430-PA 1..363 17..379 1815 100 Plus
olf186-F-RB 1056 CG11430-PB 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
olf186-F-RG 4582 CG11430-RG 236..636 16..416 2005 100 Plus
olf186-F-RF 2407 CG11430-RF 563..926 16..379 1820 100 Plus
olf186-F-RA 2080 CG11430-RA 236..599 16..379 1820 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17851097..17851461 16..380 1825 100 Plus
2R 25286936 2R 17855138..17855176 378..416 195 100 Plus
Blast to na_te.dros performed 2014-11-28 00:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6730..6958 127..358 253 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6952 95..321 247 59.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6887 174..325 205 63.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6862 200..327 203 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6838 212..337 199 66.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2314..2505 129..325 189 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..6819 232..336 183 71.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2427 200..325 179 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2417 221..337 176 67.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2424 209..325 164 61 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2747..2857 211..326 162 65 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2331..2460 200..325 154 62.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2382 250..325 145 70.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6788 272..325 143 80.4 Plus
roo 9092 roo DM_ROO 9092bp 1059..1155 201..296 140 61.9 Plus
roo 9092 roo DM_ROO 9092bp 1052..1148 234..325 137 67 Plus
roo 9092 roo DM_ROO 9092bp 1054..1154 221..325 137 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2588..2643 270..325 118 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2437..2668 94..326 117 55.4 Plus
roo 9092 roo DM_ROO 9092bp 1062..1115 272..325 116 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1518..1575 239..295 107 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2766..2835 253..325 106 64.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2593..2649 269..325 105 64.9 Plus

BS03637.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:21:05 Download gff for BS03637.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RC 1..399 17..415 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:52:52 Download gff for BS03637.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RC 219..619 16..416 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:48:56 Download gff for BS03637.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RG 237..634 17..414 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:21:05 Download gff for BS03637.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RC 219..619 16..416 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:17:31 Download gff for BS03637.complete
Subject Subject Range Query Range Percent Splice Strand
olf186-F-RG 237..634 17..414 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:17:31 Download gff for BS03637.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17851098..17851460 17..379 100 -> Plus
2R 17855140..17855174 380..414 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:48:56 Download gff for BS03637.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13738603..13738965 17..379 100 -> Plus
arm_2R 13742645..13742679 380..414 100   Plus

BS03637.pep Sequence

Translation from 16 to 414

> BS03637.pep
MSVWTTANNSGLETPTKSPITSSVPRAARSSAVITTGNHQQHHFQHVVAA
AVAAATSVATGHQFQQQFPLHAHPHPQHHSNSPTGSGSNSNNSAGFQRTS
ISNSLLQFPPPPPPSSQNQAKAGRTVQIDCRI*

BS03637.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
olf186-F-PF 351 CG11430-PF 1..121 1..121 640 100 Plus
olf186-F-PA 351 CG11430-PA 1..121 1..121 640 100 Plus
olf186-F-PB 351 CG11430-PB 1..121 1..121 640 100 Plus