Clone BS03649 Report

Search the DGRC for BS03649

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:36
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptAtg8a-RA
Protein status:BS03649.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS03649.3prime Sequence

396 bp (395 high quality bases) assembled on 2005-12-01

> BS03649.3prime
ATGGTCTAGAAAGCTTTTAGTTAATTTTGGCCATGCCGTAAACATTCTCA
TCGGAGTAGGCAATGTACAGGAAATAGTCCTCCTCGTGATGTTCCTGGTA
CAGGGAGCCCATGGTAGCCGATGTTGGTGGAATGACGTTGTTCACAAAGA
AGAAGAGGGCATCCTCGGGACGCAGGTGGATGCGCTTGCGAATGAGGAAG
TAGAACTGACCGACGGTCAGGTCGGAAGGCACCAGGTACTTCTTCTTGTC
CAAATCACCGATGCGCGCCTTGGGAGCCTTCTCGACGATGACGGGCACAC
GGTCTGGATATTTGCGACGGATCTTGTCGCCCTCGGCGCGACGCTTCTCG
AAGGCGTGCTCCTCCTTGTATTGGAACTTCATGTCGACTGATAACT

BS03649.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32672-PA 366 Atg8a-RA 1..366 382..17 1830 100 Minus
CG12334-PA 363 Atg8b-RA 58..104 331..285 160 93.6 Minus
CG12334-PA 363 Atg8b-RA 181..281 208..108 155 86.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-RA 1214 CG32672-RA 268..634 383..17 1835 100 Minus
Atg8a-RC 1183 CG32672-RC 328..603 292..17 1380 100 Minus
Atg8a-RB 1010 CG32672-RB 155..430 292..17 1380 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10765604..10765802 94..292 995 100 Plus
3R 32079331 3R 17724567..17724904 45..382 775 82 Plus
X 23542271 X 10767979..10768071 291..383 465 100 Plus
X 23542271 X 10765458..10765537 17..96 400 100 Plus
Blast to na_te.dros performed 2015-02-11 23:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 5841..5904 384..322 110 69.7 Minus

BS03649.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:29:15 Download gff for BS03649.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-PA 1..366 17..382 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:44:51 Download gff for BS03649.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32672-PA 1..366 17..382 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 14:00:50 Download gff for BS03649.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 255..635 10..391 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:59:41 Download gff for BS03649.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 258..638 10..391 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:59:41 Download gff for BS03649.3prime
Subject Subject Range Query Range Percent Splice Strand
X 10765454..10765535 10..94 96 <- Plus
X 10765605..10765802 95..292 100 <- Plus
X 10767981..10768081 293..391 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 14:00:50 Download gff for BS03649.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 10659487..10659568 10..94 96 <- Plus
arm_X 10659638..10659835 95..292 100 <- Plus
arm_X 10662014..10662114 293..391 96   Plus

BS03649.5prime Sequence

396 bp (395 high quality bases) assembled on 2005-11-29

> BS03649.5prime
GAAGTTATCAGTCGACATGAAGTTCCAATACAAGGAGGAGCACGCCTTCG
AGAAGCGTCGCGCCGAGGGCGACAAGATCCGTCGCAAATATCCAGACCGT
GTGCCCGTCATCGTCGAGAAGGCTCCCAAGGCGCGCATCGGTGATTTGGA
CAAGAAGAAGTACCTGGTGCCTTCCGACCTGACCGTCGGTCAGTTCTACT
TCCTCATTCGCAAGCGCATCCACCTGCGTCCCGAGGATGCCCTCTTCTTC
TTTGTGAACAACGTCATTCCACCAACATCGGCTACCATGGGCTCCCTGTA
CCAGGAACATCACGAGGAGGACTATTTCCTGTACATTGCCTACTCCGATG
AGAATGTTTACGGCATGGCCAAAATTAACTAAAAGCTTTCTAGACC

BS03649.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:34:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32672-PA 366 Atg8a-RA 1..366 17..382 1830 100 Plus
CG12334-PA 363 Atg8b-RA 58..104 68..114 160 93.6 Plus
CG12334-PA 363 Atg8b-RA 181..281 191..291 155 86.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-RA 1214 CG32672-RA 268..634 16..382 1835 100 Plus
Atg8a-RC 1183 CG32672-RC 328..603 107..382 1380 100 Plus
Atg8a-RB 1010 CG32672-RB 155..430 107..382 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 11:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10765604..10765802 305..107 995 100 Minus
3R 32079331 3R 17724567..17724904 354..17 775 82 Minus
X 23542271 X 10767979..10768071 108..16 465 100 Minus
X 23542271 X 10765458..10765537 382..303 400 100 Minus
Blast to na_te.dros performed 2015-02-11 11:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 5841..5904 15..77 110 69.7 Plus

BS03649.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:29:16 Download gff for BS03649.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-PA 1..366 17..382 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:44:52 Download gff for BS03649.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32672-PA 1..366 17..382 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 16:20:35 Download gff for BS03649.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 255..635 8..389 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 13:09:48 Download gff for BS03649.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 258..638 8..389 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 13:09:48 Download gff for BS03649.5prime
Subject Subject Range Query Range Percent Splice Strand
X 10765454..10765535 305..389 96 <- Minus
X 10765605..10765802 107..304 100 <- Minus
X 10767981..10768081 8..106 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 16:20:35 Download gff for BS03649.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 10659487..10659568 305..389 96 <- Minus
arm_X 10659638..10659835 107..304 100 <- Minus
arm_X 10662014..10662114 8..106 96   Minus

BS03649.complete Sequence

398 bp (398 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ638771

> BS03649.complete
GAAGTTATCAGTCGACATGAAGTTCCAATACAAGGAGGAGCACGCCTTCG
AGAAGCGTCGCGCCGAGGGCGACAAGATCCGTCGCAAATATCCAGACCGT
GTGCCCGTCATCGTCGAGAAGGCTCCCAAGGCGCGCATCGGTGATTTGGA
CAAGAAGAAGTACCTGGTGCCTTCCGACCTGACCGTCGGTCAGTTCTACT
TCCTCATTCGCAAGCGCATCCACCTGCGTCCCGAGGATGCCCTCTTCTTC
TTTGTGAACAACGTCATTCCACCAACATCGGCTACCATGGGCTCCCTGTA
CCAGGAACATCACGAGGAGGACTATTTCCTGTACATTGCCTACTCCGATG
AGAATGTTTACGGCATGGCCAAAATTAACTAAAAGCTTTCTAGACCAT

BS03649.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-RA 366 CG32672-PA 1..366 17..382 1830 100 Plus
Atg8a-RC 324 CG32672-PC 49..324 107..382 1380 100 Plus
Atg8a-RB 291 CG32672-PB 16..291 107..382 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-RA 1214 CG32672-RA 268..634 16..382 1835 100 Plus
Atg8a-RC 1183 CG32672-RC 328..603 107..382 1380 100 Plus
Atg8a-RB 1010 CG32672-RB 155..430 107..382 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10765604..10765802 305..107 995 100 Minus
3R 32079331 3R 17724567..17724904 354..17 775 82 Minus
X 23542271 X 10767979..10768071 108..16 465 100 Minus
X 23542271 X 10765458..10765537 382..303 400 100 Minus
Blast to na_te.dros performed 2014-11-27 16:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 5841..5904 15..77 110 69.7 Plus

BS03649.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:20:40 Download gff for BS03649.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 1..366 17..382 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:53:21 Download gff for BS03649.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 255..635 8..389 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:51:52 Download gff for BS03649.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 266..629 17..380 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:20:40 Download gff for BS03649.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 255..635 8..389 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:15:35 Download gff for BS03649.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8a-RA 269..632 17..380 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:15:35 Download gff for BS03649.complete
Subject Subject Range Query Range Percent Splice Strand
X 10765460..10765535 305..380 100 <- Minus
X 10765605..10765802 107..304 100 <- Minus
X 10767981..10768070 17..106 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:51:52 Download gff for BS03649.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10659493..10659568 305..380 100 <- Minus
arm_X 10659638..10659835 107..304 100 <- Minus
arm_X 10662014..10662103 17..106 100   Minus

BS03649.pep Sequence

Translation from 16 to 381

> BS03649.pep
MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHE
EDYFLYIAYSDENVYGMAKIN*

BS03649.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8a-PA 121 CG32672-PA 1..121 1..121 638 100 Plus
Atg8b-PB 120 CG12334-PB 3..118 1..116 530 82.8 Plus
Atg8b-PA 120 CG12334-PA 3..118 1..116 530 82.8 Plus
Atg8a-PC 107 CG32672-PC 7..107 21..121 482 92.1 Plus
Atg8a-PB 96 CG32672-PB 6..96 31..121 476 100 Plus