Clone BS03824 Report

Search the DGRC for BS03824

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:38
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptNtf-2-RA
Protein status:BS03824.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS03824.3prime Sequence

423 bp (422 high quality bases) assembled on 2005-12-01

> BS03824.3prime
ATGGTCTAGAAAGCTTCTAGGCAGAGTTGTGGATGTTGAGACGGAAGATG
TCGTGGGCCACAAAGAAGGTGCCTGCGTTGGCCTTCAGGAAAAAGACCTG
CGAGAAGGCATGTGGGGGATCGTCATCGCACTGTAGTCTTCCAAGGACGT
TGATCAGAACTCCGCCATCGAAAGTTGGCTGCGAGTCCACTGTGGTTATC
ACTCTGGTAATCTTCTGAAAGCTCAGACTCTGAACTTTTTCCAGAATCTT
GGGTGCCCCCTGTATTTGGTGGCCTTCAAAGGTCATGAATGAGTCGGTAG
CGCTATAGAAATTAACCACGTTCGCCCGATTCGCCGGGTCATCGAATATC
GCATAGTACTGCTGCACAAATCCCTTGCCAATGTCCTCGTACTGCGGATT
CAGCGACATGTCGACTGATAACT

BS03824.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG1740-PA 393 Ntf-2-RA 1..393 409..17 1965 100 Minus
CG10174-PA 393 Ntf-2r-RA 1..334 409..76 1120 93.4 Minus
CG10174-PA 393 Ntf-2r-RA 349..393 61..17 175 95.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-RE 3078 CG1740-RE 146..542 409..13 1970 99.7 Minus
Ntf-2-RA 755 CG1740-RA 146..542 409..13 1970 99.7 Minus
Ntf-2r-RA 771 CG10174-RA 119..525 409..3 1540 91.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18454767..18455173 409..3 1540 91.9 Minus
X 23542271 X 21038743..21038863 133..13 590 99.2 Minus
X 23542271 X 21035614..21035722 409..301 545 100 Minus
X 23542271 X 21036536..21036637 232..131 510 100 Minus
X 23542271 X 21036399..21036470 301..230 360 100 Minus
Blast to na_te.dros performed on 2015-02-10 22:37:47 has no hits.

BS03824.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:33:39 Download gff for BS03824.3prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-PA 1..393 17..409 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:50:38 Download gff for BS03824.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1740-PA 1..393 17..409 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 09:27:54 Download gff for BS03824.3prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 140..546 9..416 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:03:25 Download gff for BS03824.3prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 140..546 9..416 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:03:25 Download gff for BS03824.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18454767..18455176 1..409 91   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 09:27:54 Download gff for BS03824.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18454767..18455176 1..409 91   Minus

BS03824.5prime Sequence

423 bp (422 high quality bases) assembled on 2005-12-01

> BS03824.5prime
GAAGTTATCAGTCGACATGTCGCTGAATCCGCAGTACGAGGACATTGGCA
AGGGATTTGTGCAGCAGTACTATGCGATATTCGATGACCCGGCGAATCGG
GCGAACGTGGTTAATTTCTATAGCGCTACCGACTCATTCATGACCTTTGA
AGGCCACCAAATACAGGGGGCACCCAAGATTCTGGAAAAAGTTCAGAGTC
TGAGCTTTCAGAAGATTACCAGAGTGATAACCACAGTGGACTCGCAGCCA
ACTTTCGATGGCGGAGTTCTGATCAACGTCCTTGGAAGACTACAGTGCGA
TGACGATCCCCCACATGCCTTCTCGCAGGTCTTTTTCCTGAAGGCCAACG
CAGGCACCTTCTTTGTGGCCCACGACATCTTCCGTCTCAACATCCACAAC
TCTGCCTAGAAGCTTTCTAGACC

BS03824.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG1740-PA 393 Ntf-2-RA 1..393 17..409 1965 100 Plus
CG10174-PA 393 Ntf-2r-RA 1..334 17..350 1120 93.4 Plus
CG10174-PA 393 Ntf-2r-RA 349..393 365..409 175 95.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-RE 3078 CG1740-RE 146..542 17..413 1970 99.7 Plus
Ntf-2-RA 755 CG1740-RA 146..542 17..413 1970 99.7 Plus
Ntf-2r-RA 771 CG10174-RA 119..525 17..423 1540 91.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 14:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18454767..18455173 17..423 1540 91.9 Plus
X 23542271 X 21038743..21038863 293..413 590 99.2 Plus
X 23542271 X 21035614..21035722 17..125 545 100 Plus
X 23542271 X 21036536..21036637 194..295 510 100 Plus
X 23542271 X 21036399..21036470 125..196 360 100 Plus
Blast to na_te.dros performed on 2015-02-13 14:16:23 has no hits.

BS03824.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:33:40 Download gff for BS03824.5prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-PA 1..393 17..409 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:50:40 Download gff for BS03824.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1740-PA 1..393 17..409 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 03:03:57 Download gff for BS03824.5prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 140..546 10..417 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:07:07 Download gff for BS03824.5prime
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 140..546 10..417 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:07:07 Download gff for BS03824.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18454767..18455173 17..423 91   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 03:03:57 Download gff for BS03824.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18454767..18455173 17..423 91   Plus

BS03824.complete Sequence

425 bp (425 high quality bases) assembled on 2006-02-02

GenBank Submission: FJ634782

> BS03824.complete
GAAGTTATCAGTCGACATGTCGCTGAATCCGCAGTACGAGGACATTGGCA
AGGGATTTGTGCAGCAGTACTATGCGATATTCGATGACCCGGCGAATCGG
GCGAACGTGGTTAATTTCTATAGCGCTACCGACTCATTCATGACCTTTGA
AGGCCACCAAATACAGGGGGCACCCAAGATTCTGGAAAAAGTTCAGAGTC
TGAGCTTTCAGAAGATTACCAGAGTGATAACCACAGTGGACTCGCAGCCA
ACTTTCGATGGCGGAGTTCTGATCAACGTCCTTGGAAGACTACAGTGCGA
TGACGATCCCCCACATGCCTTCTCGCAGGTCTTTTTCCTGAAGGCCAACG
CAGGCACCTTCTTTGTGGCCCACGACATCTTCCGTCTCAACATCCACAAC
TCTGCCTAGAAGCTTTCTAGACCAT

BS03824.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-RE 393 CG1740-PE 1..393 17..409 1965 100 Plus
Ntf-2-RA 393 CG1740-PA 1..393 17..409 1965 100 Plus
Ntf-2r-RA 393 CG10174-PA 1..393 17..409 1530 92.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-RE 3078 CG1740-RE 146..542 17..413 1970 99.7 Plus
Ntf-2-RA 755 CG1740-RA 146..542 17..413 1970 99.7 Plus
Ntf-2r-RA 771 CG10174-RA 119..525 17..423 1540 91.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18454767..18455173 17..423 1540 91.9 Plus
X 23542271 X 21038743..21038863 293..413 590 99.2 Plus
X 23542271 X 21035614..21035722 17..125 545 100 Plus
X 23542271 X 21036536..21036637 194..295 510 100 Plus
X 23542271 X 21036399..21036470 125..196 360 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:05:48 has no hits.

BS03824.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:59:39 Download gff for BS03824.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 1..393 17..409 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:36:28 Download gff for BS03824.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 135..541 10..417 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:36 Download gff for BS03824.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 146..538 17..409 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:59:39 Download gff for BS03824.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 135..541 10..417 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:54 Download gff for BS03824.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2-RA 146..538 17..409 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:12:54 Download gff for BS03824.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18454767..18455159 17..409 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:36 Download gff for BS03824.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18454767..18455159 17..409 92   Plus

BS03824.pep Sequence

Translation from 16 to 408

> BS03824.pep
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFFLKANAGTFFVAHDIFRLNIHNSA*

BS03824.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2-PE 130 CG1740-PE 1..130 1..130 680 100 Plus
Ntf-2-PA 130 CG1740-PA 1..130 1..130 680 100 Plus
Ntf-2r-PA 130 CG10174-PA 1..130 1..130 594 87.7 Plus
Ntf-2-PB 129 CG1740-PB 1..128 1..128 591 88.3 Plus
Ntf-2-PC 89 CG1740-PC 1..89 42..130 462 100 Plus