Clone BS04246 Report

Search the DGRC for BS04246

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:42
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG33229-RA
Protein status:BS04246.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS04246.3prime Sequence

534 bp (533 high quality bases) assembled on 2005-12-01

> BS04246.3prime
ATGGTCTAGAAAGCTTCTAACTGGCCACGGCAATGGCGCAGCTGTGCTGC
TCATTGTTGCTGTTATTGTTATTGCTGGCGCCCGTGTAACTGTTGCTCCC
ATTGTTATTGTTGTTGCATGTGTCTTGGTTGCCATTGTTGCTGCTTAAGC
TACGCATAAAACTGTCGAGGCTACTAAGCTCGCTGCTCCATAAATTGCTT
TCCGCCTCTGCTTCTGCGGCAGCCTTGGTGGTCGAGGTCGCCACTGCAGA
GTACGCGTCACTGGCGCAGTGCGTTCTGCCGTGGGGCACAAACCGTGTTT
GAATGTCCAGCCAGCGACTGAAGCGCTCCTGCTGCTTTCTACGCAGCTCG
TGCTCTGCGTGGAGCAGGGCCGTCGACAAAATGGCGTTCACGCGTAGGTC
GCTGCCAGCGCCTCTTAGCTTGCGACGCATTTTCTGGCGCTTAACGCGGA
AGTTACGGACCCAGTCGGTTAGGGTCTTGGGGTTCTCGGCTGCGTCGCAC
TCGTCGTAGTACGCCACCATGTCGACTGATAACT

BS04246.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG33229-PA 504 CG33229-RA 1..504 520..17 2520 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG33229-RB 1754 CG33229-RB 398..906 525..17 2530 99.8 Minus
CG33229-RA 1500 CG33229-RA 144..652 525..17 2530 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 13:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 224249..224757 525..17 2530 99.8 Minus
Blast to na_te.dros performed 2015-02-06 13:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6837 145..45 213 70.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6661..6824 203..41 203 65.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2419 145..34 191 68.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2512 216..45 181 58.7 Minus
roo 9092 roo DM_ROO 9092bp 1063..1158 153..55 172 68 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6813..6912 145..45 161 66.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..6919 222..54 158 61.5 Minus
roo 9092 roo DM_ROO 9092bp 1006..1179 232..57 145 57.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2455..2550 151..57 136 64.6 Minus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2608..2685 139..62 129 62.8 Minus
roo 9092 roo DM_ROO 9092bp 1062..1158 199..103 125 58.8 Minus
accord2 7650 accord2 QBERT 7650bp 4407..4493 54..140 119 65.6 Plus

BS04246.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:43:39 Download gff for BS04246.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33229-PA 1..504 17..520 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 08:03:33 Download gff for BS04246.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33229-PA 1..504 17..520 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 08:53:54 Download gff for BS04246.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33229-RA 138..652 17..534 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 14:00:34 Download gff for BS04246.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33229-RA 138..652 17..534 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 14:00:34 Download gff for BS04246.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 224243..224757 17..534 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 08:53:54 Download gff for BS04246.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 224243..224757 17..534 99   Minus

BS04246.5prime Sequence

534 bp (533 high quality bases) assembled on 2005-11-29

> BS04246.5prime
GAAGTTATCAGTCGACATGGTGGCGTACTACGACGAGTGCGACGCAGCCG
AGAACCCCAAGACCCTAACCGACTGGGTCCGTAACTTCCGCGTTAAGCGC
CAGAAAATGCGTCGCAAGCTAAGAGGCGCTGGCAGCGACCTACGCGTGAA
CGCCATTTTGTCGACGGCCCTGCTCCACGCAGAGCACGAGCTGCGTAGAA
AGCAGCAGGAGCGCTTCAGTCGCTGGCTGGACATTCAAACACGGTTTGTG
CCCCACGGCAGAACGCACTGCGCCAGTGACGCGTACTCTGCAGTGGCGAC
CTCGACCACCAAGGCTGCCGCAGAAGCAGAGGCGGAAAGCAATTTATGGA
GCAGCGAGCTTAGTAGCCTCGACAGTTTTATGCGTAGCTTAAGCAGCAAC
AATGGCAACCAAGACACATGCAACAACAATAACAATGGGAGCAACAGTTA
CACGGGCGCCAGCAATAACAATAACAGCAACAATGAGCAGCACAGCTGCG
CCATTGCCGTGGCCAGTTAGAAGCTTTCTAGACC

BS04246.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 16:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG33229-PA 504 CG33229-RA 1..504 17..520 2520 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG33229-RB 1754 CG33229-RB 398..906 12..520 2530 99.8 Plus
CG33229-RA 1500 CG33229-RA 144..652 12..520 2530 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 224249..224757 12..520 2530 99.8 Plus
Blast to na_te.dros performed 2015-02-11 17:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6837 392..492 213 70.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6661..6824 334..496 203 65.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2419 392..503 191 68.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2512 321..492 181 58.7 Plus
roo 9092 roo DM_ROO 9092bp 1063..1158 384..482 172 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6813..6912 392..492 161 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..6919 315..483 158 61.5 Plus
roo 9092 roo DM_ROO 9092bp 1006..1179 305..480 145 57.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2455..2550 386..480 136 64.6 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2608..2685 398..475 129 62.8 Plus
roo 9092 roo DM_ROO 9092bp 1062..1158 338..434 125 58.8 Plus
accord2 7650 accord2 QBERT 7650bp 4407..4493 483..397 119 65.6 Minus

BS04246.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 07:43:40 Download gff for BS04246.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33229-PA 1..504 17..520 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 08:03:34 Download gff for BS04246.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33229-PA 1..504 17..520 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 16:28:01 Download gff for BS04246.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33229-RA 137..652 1..520 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:31:01 Download gff for BS04246.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33229-RA 137..652 1..520 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:31:01 Download gff for BS04246.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 224242..224757 1..520 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 16:28:01 Download gff for BS04246.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 224242..224757 1..520 99   Plus

BS04246.complete Sequence

536 bp (536 high quality bases) assembled on 2006-02-02

GenBank Submission: FJ634896

> BS04246.complete
GAAGTTATCAGTCGACATGGTGGCGTACTACGACGAGTGCGACGCAGCCG
AGAACCCCAAGACCCTAACCGACTGGGTCCGTAACTTCCGCGTTAAGCGC
CAGAAAATGCGTCGCAAGCTAAGAGGCGCTGGCAGCGACCTACGCGTGAA
CGCCATTTTGTCGACGGCCCTGCTCCACGCAGAGCACGAGCTGCGTAGAA
AGCAGCAGGAGCGCTTCAGTCGCTGGCTGGACATTCAAACACGGTTTGTG
CCCCACGGCAGAACGCACTGCGCCAGTGACGCGTACTCTGCAGTGGCGAC
CTCGACCACCAAGGCTGCCGCAGAAGCAGAGGCGGAAAGCAATTTATGGA
GCAGCGAGCTTAGTAGCCTCGACAGTTTTATGCGTAGCTTAAGCAGCAAC
AATGGCAACCAAGACACATGCAACAACAATAACAATGGGAGCAACAGTTA
CACGGGCGCCAGCAATAACAATAACAGCAACAATGAGCAGCACAGCTGCG
CCATTGCCGTGGCCAGTTAGAAGCTTTCTAGACCAT

BS04246.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG33229-RB 504 CG33229-PB 1..504 17..520 2520 100 Plus
CG33229-RA 504 CG33229-PA 1..504 17..520 2520 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG33229-RB 1754 CG33229-RB 398..906 12..520 2530 99.8 Plus
CG33229-RA 1500 CG33229-RA 144..652 12..520 2530 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 224249..224757 12..520 2530 99.8 Plus
Blast to na_te.dros performed 2014-11-27 13:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6837 392..492 213 70.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6661..6824 334..496 203 65.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2419 392..503 191 68.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2512 321..492 181 58.7 Plus
roo 9092 roo DM_ROO 9092bp 1063..1158 384..482 172 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6813..6912 392..492 161 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..6919 315..483 158 61.5 Plus
roo 9092 roo DM_ROO 9092bp 1006..1179 305..480 145 57.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2455..2550 386..480 136 64.6 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2608..2685 398..475 129 62.8 Plus
roo 9092 roo DM_ROO 9092bp 1062..1158 338..434 125 58.8 Plus
accord2 7650 accord2 QBERT 7650bp 4407..4493 483..397 119 65.6 Minus

BS04246.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:46:53 Download gff for BS04246.complete
Subject Subject Range Query Range Percent Splice Strand
CG33229-RA 1..504 17..520 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:22:02 Download gff for BS04246.complete
Subject Subject Range Query Range Percent Splice Strand
CG33229-RA 112..627 1..520 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:27:51 Download gff for BS04246.complete
Subject Subject Range Query Range Percent Splice Strand
CG33229-RA 149..652 17..520 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:46:54 Download gff for BS04246.complete
Subject Subject Range Query Range Percent Splice Strand
CG33229-RA 112..627 1..520 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:13:23 Download gff for BS04246.complete
Subject Subject Range Query Range Percent Splice Strand
CG33229-RA 149..652 17..520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:13:23 Download gff for BS04246.complete
Subject Subject Range Query Range Percent Splice Strand
3L 224254..224757 17..520 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:27:51 Download gff for BS04246.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 224254..224757 17..520 100   Plus

BS04246.pep Sequence

Translation from 16 to 519

> BS04246.pep
MVAYYDECDAAENPKTLTDWVRNFRVKRQKMRRKLRGAGSDLRVNAILST
ALLHAEHELRRKQQERFSRWLDIQTRFVPHGRTHCASDAYSAVATSTTKA
AAEAEAESNLWSSELSSLDSFMRSLSSNNGNQDTCNNNNNGSNSYTGASN
NNNSNNEQHSCAIAVAS*

BS04246.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG33229-PB 167 CG33229-PB 1..167 1..167 870 100 Plus
CG33229-PA 167 CG33229-PA 1..167 1..167 870 100 Plus