Clone BS05915 Report

Search the DGRC for BS05915

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:59
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptMs-RA
Protein status:BS05915.pep: full length peptide match
Sequenced Size:335

Clone Sequence Records

BS05915.5prime Sequence

333 bp (332 high quality bases) assembled on 2005-12-03

> BS05915.5prime
GAAGTTATCAGTCGACATGTCTTTCGCTCAGTTCTTTGTCGCCTGCTGCC
TGGCCATCGTCCTCCTGGCCGTGTCCAACACACGGGCCGCAGTTCAGGGT
CCACCTCTATGCCAGTCTGGCATCGTCGAGGAGATGCCGCCGCACATCCG
GAAGGTGTGCCAGGCCCTGGAGAACTCCGATCAACTGACGTCGGCGCTGA
AGTCCTACATCAACAACGAGGCATCCGCTTTGGTGGCCAACTCTGATGAC
CTGTTGAAGAACTACAACAAGCGAACGGATGTCGATCACGTCTTCCTGCG
TTTCGGAAAACGTCGTTAAAAGCTTTCTAGACC

BS05915.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 17:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG6440-PA 303 Dms-RA 1..303 17..319 1490 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 908 CG6440-RB 114..417 16..319 1505 99.7 Plus
Ms-RC 1065 CG6440-RC 131..434 16..319 1505 99.7 Plus
Ms-RA 925 CG6440-RA 131..434 16..319 1505 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24342828..24343039 16..227 1045 99.5 Plus
3R 32079331 3R 24343102..24343194 227..319 465 100 Plus
Blast to na_te.dros performed on 2015-02-11 16:14:23 has no hits.

BS05915.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 08:26:07 Download gff for BS05915.5prime
Subject Subject Range Query Range Percent Splice Strand
Dms-PA 1..303 17..319 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 08:59:56 Download gff for BS05915.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6440-PA 1..303 17..319 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 14:36:04 Download gff for BS05915.5prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..441 8..326 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:55:10 Download gff for BS05915.5prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..441 8..326 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:55:10 Download gff for BS05915.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 24343103..24343201 228..326 96   Plus
3R 24342828..24343039 16..227 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 14:36:04 Download gff for BS05915.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168550..20168761 16..227 99 -> Plus
arm_3R 20168825..20168923 228..326 96   Plus

BS05915.3prime Sequence

333 bp (332 high quality bases) assembled on 2005-12-03

> BS05915.3prime
ATGGTCTAGAAAGCTTTTAACGACGTTTTCCGAAACGCAGGAAGACGTGA
TCGACATCCGTTCGCTTGTTGTAGTTCTTCAACAGGTCATCAGAGTTGGC
CACCAAAGCGGATGCCTCGTTGTTGATGTAGGACTTCAGCGCCGACGTCA
GTTGATCGGAGTTCTCCAGGGCCTGGCACACCTTCCGGATGTGCGGCGGC
ATCTCCTCGACGATGCCAGACTGGCATAGAGGTGGACCCTGAACTGCGGC
CCGTGTGTTGGACACGGCCAGGAGGACGATGGCCAGGCAGCAGGCGACAA
AGAACTGAGCGAAAGACATGTCGACTGATAACT

BS05915.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 17:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG6440-PA 303 Dms-RA 1..303 319..17 1490 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 908 CG6440-RB 114..417 320..17 1505 99.7 Minus
Ms-RC 1065 CG6440-RC 131..434 320..17 1505 99.7 Minus
Ms-RA 925 CG6440-RA 131..434 320..17 1505 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24342828..24343039 320..109 1045 99.5 Minus
3R 32079331 3R 24343102..24343194 109..17 465 100 Minus
Blast to na_te.dros performed on 2015-02-02 18:18:21 has no hits.

BS05915.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 08:26:06 Download gff for BS05915.3prime
Subject Subject Range Query Range Percent Splice Strand
Dms-PA 1..303 17..319 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 08:59:54 Download gff for BS05915.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6440-PA 1..303 17..319 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 18:09:49 Download gff for BS05915.3prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..441 10..328 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 20:52:02 Download gff for BS05915.3prime
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 124..441 10..328 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 20:52:02 Download gff for BS05915.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 24342828..24343039 109..320 99 -> Minus
3R 24343103..24343201 10..108 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 18:09:49 Download gff for BS05915.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168550..20168761 109..320 99 -> Minus
arm_3R 20168825..20168923 10..108 96   Minus

BS05915.complete Sequence

335 bp assembled on 2008-08-15

GenBank Submission: FJ635297

> BS05915.complete
GAAGTTATCAGTCGACATGTCTTTCGCTCAGTTCTTTGTCGCCTGCTGCC
TGGCCATCGTCCTCCTGGCCGTGTCCAACACACGGGCCGCAGTTCAGGGT
CCACCTCTATGCCAGTCTGGCATCGTCGAGGAGATGCCGCCGCACATCCG
GAAGGTGTGCCAGGCCCTGGAGAACTCCGATCAACTGACGTCGGCGCTGA
AGTCCTACATCAACAACGAGGCATCCGCTTTGGTGGCCAACTCTGATGAC
CTGTTGAAGAACTACAACAAGCGAACGGATGTCGATCACGTCTTCCTGCG
TTTCGGAAAACGTCGTTAAAAGCTTTCTAGACCAT

BS05915.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 303 CG6440-PB 1..303 17..319 1500 99.7 Plus
Ms-RC 303 CG6440-PC 1..303 17..319 1500 99.7 Plus
Ms-RA 303 CG6440-PA 1..303 17..319 1500 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-RB 908 CG6440-RB 114..417 16..319 1505 99.7 Plus
Ms-RC 1065 CG6440-RC 131..434 16..319 1505 99.7 Plus
Ms-RA 925 CG6440-RA 131..434 16..319 1505 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24342828..24343039 16..227 1045 99.5 Plus
3R 32079331 3R 24343102..24343194 227..319 465 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:57:23 has no hits.

BS05915.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:59:13 Download gff for BS05915.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 122..439 8..326 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:44 Download gff for BS05915.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 132..432 17..317 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 17:57:05 Download gff for BS05915.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 130..430 17..317 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:00:00 Download gff for BS05915.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 132..432 17..317 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:00:00 Download gff for BS05915.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24342829..24343039 17..227 99 -> Plus
3R 24343103..24343192 228..317 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:44 Download gff for BS05915.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168551..20168761 17..227 99 -> Plus
arm_3R 20168825..20168914 228..317 100   Plus

BS05915.pep Sequence

Translation from 16 to 318

> BS05915.pep
MSFAQFFVACCLAIVLLAVSNTRAAVQGPPLCQSGIVEEMPPHIRKVCQA
LENSDQLTSALKSYINNEASALVANSDDLLKNYNKRTDVDHVFLRFGKRR
*

BS05915.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-PB 100 CG6440-PB 1..100 1..100 511 100 Plus
Ms-PC 100 CG6440-PC 1..100 1..100 511 100 Plus
Ms-PA 100 CG6440-PA 1..100 1..100 511 100 Plus