Clone BS07110 Report

Search the DGRC for BS07110

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:71
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptNP15.6-RA
Protein status:BS07110.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS07110.5prime Sequence

483 bp (482 high quality bases) assembled on 2006-01-06

> BS07110.5prime
GAAGTTATCAGTCGACATGTCTGCGCTGTTCCGTCTGACCAACCGCGCCG
TGGCGCTGCAGCGTTCCCTGGTCGCCAACCAGGCGGCAGTGGTGCGGGCA
ATCAACACGTCGCCGAAGAAGGATGAGACCATCACGGCCCCCACTTCACT
TACGACCGAGGACTTTGCCAATCCGAGTCCCAAGAACTGGCAGAGCTACG
GATTCGACTACAAGGACCAGGTGGAGGATCGCAAGGCCACCAAGTCGACG
TTCTTCGTTACGGTGACACTGTGCCTGGTGTGGGGCAGCTTCTACTGGGC
CTACCTGCCCGACACTCAGTTCCGCAACTGGGCCCAGCGTGAGGGCTTCT
TGGAGCTGCGTCGCCGCGAACTGGCCGGCGTGGATTTGGTCAGCCCCAAC
TACGTGGACCCCGCCAGCATTACACTGCCCTCGGACGAGGATCTGGGCGA
CACCGAGATCATCATCTAAAAGCTTTCTAGACC

BS07110.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 17:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG6008-PA 453 NP15.6-RA 1..453 17..469 2265 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
NP15.6-RA 648 CG6008-RA 81..534 17..470 2270 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 14:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19027448..19027901 17..470 2270 100 Plus
Blast to na_te.dros performed on 2015-02-13 14:15:42 has no hits.

BS07110.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 09:02:25 Download gff for BS07110.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6008-PA 1..453 17..469 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 09:48:49 Download gff for BS07110.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6008-PA 1..453 17..469 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 03:03:50 Download gff for BS07110.5prime
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 93..557 13..480 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:05:37 Download gff for BS07110.5prime
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 77..541 13..480 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:05:37 Download gff for BS07110.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 19027444..19027908 13..480 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 03:03:50 Download gff for BS07110.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14853166..14853630 13..480 98   Plus

BS07110.3prime Sequence

483 bp (482 high quality bases) assembled on 2006-01-06

> BS07110.3prime
ATGGTCTAGAAAGCTTTTAGATGATGATCTCGGTGTCGCCCAGATCCTCG
TCCGAGGGCAGTGTAATGCTGGCGGGGTCCACGTAGTTGGGGCTGACCAA
ATCCACGCCGGCCAGTTCGCGGCGACGCAGCTCCAAGAAGCCCTCACGCT
GGGCCCAGTTGCGGAACTGAGTGTCGGGCAGGTAGGCCCAGTAGAAGCTG
CCCCACACCAGGCACAGTGTCACCGTAACGAAGAACGTCGACTTGGTGGC
CTTGCGATCCTCCACCTGGTCCTTGTAGTCGAATCCGTAGCTCTGCCAGT
TCTTGGGACTCGGATTGGCAAAGTCCTCGGTCGTAAGTGAAGTGGGGGCC
GTGATGGTCTCATCCTTCTTCGGCGACGTGTTGATTGCCCGCACCACTGC
CGCCTGGTTGGCGACCAGGGAACGCTGCAGCGCCACGGCGCGGTTGGTCA
GACGGAACAGCGCAGACATGTCGACTGATAACT

BS07110.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 17:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG6008-PA 453 NP15.6-RA 1..453 469..17 2265 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 14:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
NP15.6-RA 648 CG6008-RA 81..534 469..16 2270 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 14:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19027448..19027901 469..16 2270 100 Minus
Blast to na_te.dros performed on 2015-01-30 14:19:02 has no hits.

BS07110.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 09:02:24 Download gff for BS07110.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6008-PA 1..453 17..469 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 09:48:48 Download gff for BS07110.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6008-PA 1..453 17..469 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 11:02:01 Download gff for BS07110.3prime
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 93..557 6..473 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:33:41 Download gff for BS07110.3prime
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 77..541 6..473 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 17:33:41 Download gff for BS07110.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 19027444..19027908 6..473 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 11:02:01 Download gff for BS07110.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14853166..14853630 6..473 98   Minus

BS07110.complete Sequence

485 bp (485 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ635732

> BS07110.complete
GAAGTTATCAGTCGACATGTCTGCGCTGTTCCGTCTGACCAACCGCGCCG
TGGCGCTGCAGCGTTCCCTGGTCGCCAACCAGGCGGCAGTGGTGCGGGCA
ATCAACACGTCGCCGAAGAAGGATGAGACCATCACGGCCCCCACTTCACT
TACGACCGAGGACTTTGCCAATCCGAGTCCCAAGAACTGGCAGAGCTACG
GATTCGACTACAAGGACCAGGTGGAGGATCGCAAGGCCACCAAGTCGACG
TTCTTCGTTACGGTGACACTGTGCCTGGTGTGGGGCAGCTTCTACTGGGC
CTACCTGCCCGACACTCAGTTCCGCAACTGGGCCCAGCGTGAGGGCTTCT
TGGAGCTGCGTCGCCGCGAACTGGCCGGCGTGGATTTGGTCAGCCCCAAC
TACGTGGACCCCGCCAGCATTACACTGCCCTCGGACGAGGATCTGGGCGA
CACCGAGATCATCATCTAAAAGCTTTCTAGACCAT

BS07110.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
NP15.6-RA 453 CG6008-PA 1..453 17..469 2265 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
NP15.6-RA 648 CG6008-RA 81..534 17..470 2270 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19027448..19027901 17..470 2270 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:26:23 has no hits.

BS07110.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:49:22 Download gff for BS07110.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 1..453 17..469 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:37:41 Download gff for BS07110.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 93..557 13..480 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:46:47 Download gff for BS07110.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 97..547 17..467 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:49:22 Download gff for BS07110.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 93..557 13..480 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:41 Download gff for BS07110.complete
Subject Subject Range Query Range Percent Splice Strand
NP15.6-RA 81..531 17..467 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:41 Download gff for BS07110.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19027448..19027898 17..467 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:46:47 Download gff for BS07110.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14853170..14853620 17..467 100   Plus

BS07110.pep Sequence

Translation from 16 to 468

> BS07110.pep
MSALFRLTNRAVALQRSLVANQAAVVRAINTSPKKDETITAPTSLTTEDF
ANPSPKNWQSYGFDYKDQVEDRKATKSTFFVTVTLCLVWGSFYWAYLPDT
QFRNWAQREGFLELRRRELAGVDLVSPNYVDPASITLPSDEDLGDTEIII
*

BS07110.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
NP15.6-PA 150 CG6008-PA 1..150 1..150 779 100 Plus