Clone BS07261 Report

Search the DGRC for BS07261

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:72
Well:61
Vector:pDNR-Dual
Associated Gene/Transcripteff-RA
Protein status:BS07261.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS07261.3prime Sequence

474 bp (473 high quality bases) assembled on 2006-01-06

> BS07261.3prime
ATGGTCTAGAAAGCTTTCACATAGCATACTTTCTAGTCCACTCTCGTGCC
AGCTCATTGTATTTTTCCCGATCGGTTTTATATATTCTGGCAATCTCTGG
AACAAGAGGATCGTCTGGATTGGGATCACAGAGTAGAGAGCAAATTGATA
ATAAAACTTTTGAAATAGTTAATGCTGGCGACCACTGAGATCTTAATATA
TCGAGACAAATCGATCCATTGCTGTTGATGTTTGGATGGTATATGCGCGT
TGTAAAAGCCACTTTGGGTGGTTTAAAGGGATAGTCTGTTGGAAAATGTA
TAGTTAAGAAGAATACACCTCCTTGATAAGGGCTGTCCGGCGGGCCCATT
ATTGTAGCTTGCCAGTGAAATAAATCATCTCCAACTGGACCGGCTGAACA
TTGTGCAGGTGGATCTCTGCCCAGATCTTGCAGTTCCTTATTGATTCTTT
TTAACGCCATGTCGACTGATAACT

BS07261.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 17:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG7425-PA 444 eff-RA 1..444 460..17 2220 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
eff-RC 1913 CG7425-RC 389..832 460..17 2220 100 Minus
eff-RB 1622 CG7425-RB 389..832 460..17 2220 100 Minus
eff-RA 2084 CG7425-RA 851..1294 460..17 2220 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14733700..14733884 157..341 925 100 Plus
3R 32079331 3R 14733495..14733636 17..158 710 100 Plus
3R 32079331 3R 14737420..14737485 373..438 330 100 Plus
Blast to na_te.dros performed on 2015-02-10 18:58:33 has no hits.

BS07261.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 09:07:28 Download gff for BS07261.3prime
Subject Subject Range Query Range Percent Splice Strand
eff-PA 1..444 17..460 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 09:55:40 Download gff for BS07261.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7425-PA 1..444 17..460 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 19:08:37 Download gff for BS07261.3prime
Subject Subject Range Query Range Percent Splice Strand
eff-RA 843..1305 5..470 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:20:03 Download gff for BS07261.3prime
Subject Subject Range Query Range Percent Splice Strand
eff-RA 843..1305 5..470 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 21:20:03 Download gff for BS07261.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 14733484..14733634 5..156 97 <- Plus
3R 14733700..14733883 157..340 100 <- Plus
3R 14734387..14734418 341..372 100 <- Plus
3R 14737420..14737483 373..436 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 19:08:37 Download gff for BS07261.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10559206..10559356 5..156 97 <- Plus
arm_3R 10559422..10559605 157..340 100 <- Plus
arm_3R 10560109..10560140 341..372 100 <- Plus
arm_3R 10563142..10563205 373..436 100 <- Plus

BS07261.5prime Sequence

474 bp (473 high quality bases) assembled on 2006-01-06

> BS07261.5prime
GAAGTTATCAGTCGACATGGCGTTAAAAAGAATCAATAAGGAACTGCAAG
ATCTGGGCAGAGATCCACCTGCACAATGTTCAGCCGGTCCAGTTGGAGAT
GATTTATTTCACTGGCAAGCTACAATAATGGGCCCGCCGGACAGCCCTTA
TCAAGGAGGTGTATTCTTCTTAACTATACATTTTCCAACAGACTATCCCT
TTAAACCACCCAAAGTGGCTTTTACAACGCGCATATACCATCCAAACATC
AACAGCAATGGATCGATTTGTCTCGATATATTAAGATCTCAGTGGTCGCC
AGCATTAACTATTTCAAAAGTTTTATTATCAATTTGCTCTCTACTCTGTG
ATCCCAATCCAGACGATCCTCTTGTTCCAGAGATTGCCAGAATATATAAA
ACCGATCGGGAAAAATACAATGAGCTGGCACGAGAGTGGACTAGAAAGTA
TGCTATGTGAAAGCTTTCTAGACC

BS07261.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 17:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG7425-PA 444 eff-RA 1..444 17..460 2220 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 04:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
eff-RC 1913 CG7425-RC 389..832 17..460 2220 100 Plus
eff-RB 1622 CG7425-RB 389..832 17..460 2220 100 Plus
eff-RA 2084 CG7425-RA 851..1294 17..460 2220 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 04:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14733700..14733884 320..136 925 100 Minus
3R 32079331 3R 14733495..14733636 460..319 710 100 Minus
3R 32079331 3R 14737420..14737485 104..39 330 100 Minus
Blast to na_te.dros performed on 2015-02-10 04:37:10 has no hits.

BS07261.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 09:07:29 Download gff for BS07261.5prime
Subject Subject Range Query Range Percent Splice Strand
eff-PA 1..444 17..460 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 09:55:42 Download gff for BS07261.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7425-PA 1..444 17..460 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 08:49:07 Download gff for BS07261.5prime
Subject Subject Range Query Range Percent Splice Strand
eff-RA 843..1305 7..472 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 05:24:43 Download gff for BS07261.5prime
Subject Subject Range Query Range Percent Splice Strand
eff-RA 843..1305 7..472 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 05:24:43 Download gff for BS07261.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 14733484..14733634 321..472 97 <- Minus
3R 14733700..14733883 137..320 100 <- Minus
3R 14734387..14734418 105..136 100 <- Minus
3R 14737420..14737483 41..104 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 08:49:07 Download gff for BS07261.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10559206..10559356 321..472 97 <- Minus
arm_3R 10559422..10559605 137..320 100 <- Minus
arm_3R 10560109..10560140 105..136 100 <- Minus
arm_3R 10563142..10563205 41..104 100 <- Minus

BS07261.complete Sequence

476 bp (476 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ635791

> BS07261.complete
GAAGTTATCAGTCGACATGGCGTTAAAAAGAATCAATAAGGAACTGCAAG
ATCTGGGCAGAGATCCACCTGCACAATGTTCAGCCGGTCCAGTTGGAGAT
GATTTATTTCACTGGCAAGCTACAATAATGGGCCCGCCGGACAGCCCTTA
TCAAGGAGGTGTATTCTTCTTAACTATACATTTTCCAACAGACTATCCCT
TTAAACCACCCAAAGTGGCTTTTACAACGCGCATATACCATCCAAACATC
AACAGCAATGGATCGATTTGTCTCGATATATTAAGATCTCAGTGGTCGCC
AGCATTAACTATTTCAAAAGTTTTATTATCAATTTGCTCTCTACTCTGTG
ATCCCAATCCAGACGATCCTCTTGTTCCAGAGATTGCCAGAATATATAAA
ACCGATCGGGAAAAATACAATGAGCTGGCACGAGAGTGGACTAGAAAGTA
TGCTATGTGAAAGCTTTCTAGACCAT

BS07261.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
eff-RC 444 CG7425-PC 1..444 17..460 2220 100 Plus
eff-RB 444 CG7425-PB 1..444 17..460 2220 100 Plus
eff-RA 444 CG7425-PA 1..444 17..460 2220 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
eff-RC 1913 CG7425-RC 389..832 17..460 2220 100 Plus
eff-RB 1622 CG7425-RB 389..832 17..460 2220 100 Plus
eff-RA 2084 CG7425-RA 851..1294 17..460 2220 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14733700..14733884 320..136 925 100 Minus
3R 32079331 3R 14733495..14733636 460..319 710 100 Minus
3R 32079331 3R 14737420..14737485 104..39 330 100 Minus
Blast to na_te.dros performed on 2014-11-28 01:22:47 has no hits.

BS07261.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:08:48 Download gff for BS07261.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 1..444 17..460 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:48:09 Download gff for BS07261.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 735..1197 7..472 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:48:02 Download gff for BS07261.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 851..1293 17..459 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:08:48 Download gff for BS07261.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 735..1197 7..472 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:52:30 Download gff for BS07261.complete
Subject Subject Range Query Range Percent Splice Strand
eff-RA 851..1293 17..459 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:52:30 Download gff for BS07261.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14733496..14733634 321..459 100 <- Minus
3R 14733700..14733883 137..320 100 <- Minus
3R 14734387..14734418 105..136 100 <- Minus
3R 14737420..14737483 41..104 100 <- Minus
3R 14740380..14740403 17..40 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:48:02 Download gff for BS07261.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10559218..10559356 321..459 100 <- Minus
arm_3R 10559422..10559605 137..320 100 <- Minus
arm_3R 10560109..10560140 105..136 100 <- Minus
arm_3R 10563142..10563205 41..104 100 <- Minus
arm_3R 10566102..10566125 17..40 100   Minus

BS07261.pep Sequence

Translation from 16 to 459

> BS07261.pep
MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVF
FLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTIS
KVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM*

BS07261.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
eff-PC 147 CG7425-PC 1..147 1..147 804 100 Plus
eff-PB 147 CG7425-PB 1..147 1..147 804 100 Plus
eff-PA 147 CG7425-PA 1..147 1..147 804 100 Plus
Ubc2-PD 232 CG6720-PD 89..231 4..146 513 66.4 Plus
Ubc2-PC 232 CG6720-PC 89..231 4..146 513 66.4 Plus