Clone BS08448 Report

Search the DGRC for BS08448

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:84
Well:48
Vector:pDNR-Dual
Associated Gene/Transcriptdlg1-RC
Protein status:BS08448.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS08448.3prime Sequence

657 bp (656 high quality bases) assembled on 2006-01-10

> BS08448.3prime
ATGGTCTAGAAAGCTTCTAGGTGGACTCAAAAGCGCGCTTAAGCATTTTG
GCTTGAATGCCGTTGTTATGGCGAAGTTGGTAATGGTGTTGGTGTTGAAT
TTGGCTTTGATGTTGATGTTGATGTGGATGGAGGCTCACGAGGACTCGCT
TGCGCTGGTGTGCGTTTGGGTATGTCTGTGTAAGTGACTGTATCTGTATC
TGTGAAGTCTGGGACCCGCTCCTCGATTTGGATCCCTGCTGCTGCTGCGG
ATTCTGCTGCTGCGGGGAGCGGGAACTGCGCTGCTGCGCTTGCTGCTGCT
TTTGCTGCTGCTCGACAGTTGGCTCCTTGGCATTTTCCGTGTCCGATTCG
ATGCGCATGCGCTGATTATCAGCTATTTTGACTGCCTCCCCCTCCTTTTC
CCATTTGGTTGCAATTTGCAAGGTCTCCGCTGTCTTTTGTTGTATGCTCT
TCGAGTCATCCAATAATGTCAATTCATAGAATTCTTGTATATCTAACAGC
GCTTGAAACAAGCGAGATTTAAATATGCGTATAACGCGTTCGATTGCAAT
ACGCAGCGCCCGATCCTGCGGCTCCGAAAGTCTCGCGTGGTAGTCCTCGA
GCAGCTCGAGAGCCCGATGAGCTTCTTGCTTTTTCACTGGCATGTCGACT
GATAACT

BS08448.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 18:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG1725-PC 627 dlg1-RC 1..627 643..17 3060 99.5 Minus
CG1725-PJ 627 dlg1-RJ 1..627 643..17 3060 99.5 Minus
CG1725-PI 627 dlg1-RI 1..627 643..17 3060 99.5 Minus
CG1725-PH 2736 dlg1-RH 1..438 643..206 2115 99.3 Minus
CG1725-PB 2913 dlg1-RB 1..276 643..368 1305 98.9 Minus
CG1725-PF 2451 dlg1-RF 911..1167 624..368 1210 98.8 Minus
CG1725-PB 2913 dlg1-RB 454..615 367..206 810 100 Minus
CG1725-PF 2451 dlg1-RF 1345..1506 367..206 810 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 11:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RI 2114 CG1725-RI 371..997 643..17 3090 99.5 Minus
dlg1-RJ 2102 CG1725-RJ 359..985 643..17 3090 99.5 Minus
dlg1-RC 2554 CG1725-RC 811..1437 643..17 3090 99.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 11:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11387986..11388174 205..17 945 100 Minus
X 23542271 X 11387772..11387933 367..206 810 100 Minus
X 23542271 X 11376840..11376973 626..493 670 100 Minus
X 23542271 X 11381854..11381980 494..368 590 97.6 Minus
Blast to na_te.dros performed 2015-02-06 11:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2285..2538 332..76 222 57.7 Minus
Doc3-element 4740 Doc3-element DOC3 4740bp 549..634 130..46 130 62.8 Minus
rover 7318 rover ROVER 7318bp 1930..1997 115..48 123 68.1 Minus

BS08448.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 09:40:52 Download gff for BS08448.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1725-PC 1..627 17..643 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 10:40:03 Download gff for BS08448.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1725-PJ 1..627 17..643 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 08:32:15 Download gff for BS08448.3prime
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 804..1440 10..652 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:41:59 Download gff for BS08448.3prime
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 804..1440 10..652 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:41:59 Download gff for BS08448.3prime
Subject Subject Range Query Range Percent Splice Strand
X 11387986..11388177 10..205 97   Minus
X 11376842..11376973 493..624 100 -> Minus
X 11381856..11381980 368..492 97 -> Minus
X 11387772..11387933 206..367 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 08:32:15 Download gff for BS08448.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11275889..11276013 368..492 97 -> Minus
arm_X 11270875..11271006 493..624 100 -> Minus
arm_X 11281805..11281966 206..367 100 -> Minus
arm_X 11282019..11282210 10..205 97   Minus

BS08448.5prime Sequence

657 bp (656 high quality bases) assembled on 2006-01-10

> BS08448.5prime
GAAGTTATCAGTCGACATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTC
TCGAGCTGCTCGAGGACTACCACGCGAGACTTTCGGAGCCGCAGGATCGG
GCGCTGCGTATTGCAATCGAACGCGTTATACGCATATTTAAATCTCGCTT
GTTTCAAGCGCTGTTAGATATACAAGAATTCTATGAATTGACATTATTGG
ATGACTCGAAGAGCATACAACAAAAGACAGCGGAGACCTTGCAAATTGCA
ACCAAATGGGAAAAGGATGGCCAGGCAGTCAAAATAGCTGATAATCAGCG
CATGCGCATCGAATCGGACACGGAAAATGCCAAGGAGCCAACTGTCGAGC
AGCAGCAAAAGCAGCAGCAAGCGCAGCAGCGCAGTTCCCGCTCCCCGCAG
CAGCAGAATCCGCAGCAGCAGCAGGGATCCAAATCGAGGAGCGGGTCCCA
GACTTCACAGATACAGATACAGTCACTTACACAGACATACCCAAACGCAC
ACCAGCGCAAGCGAGTCCTCGTGAGCCTCCATCCACATCAACATCAACAT
CAAAGCCAAATTCAACACCAACACCATTACCAACTTCGCCATAACAACGG
CATTCAAGCCAAAATGCTTAAGCGCGCTTTTGAGTCCACCTAGAAGCTTT
CTAGACC

BS08448.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 18:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG1725-PC 627 dlg1-RC 1..627 17..643 3135 100 Plus
CG1725-PJ 627 dlg1-RJ 1..627 17..643 3135 100 Plus
CG1725-PI 627 dlg1-RI 1..627 17..643 3135 100 Plus
CG1725-PH 2736 dlg1-RH 1..438 17..454 2190 100 Plus
CG1725-PB 2913 dlg1-RB 1..276 17..292 1380 100 Plus
CG1725-PF 2451 dlg1-RF 911..1167 36..292 1285 100 Plus
CG1725-PB 2913 dlg1-RB 454..615 293..454 810 100 Plus
CG1725-PF 2451 dlg1-RF 1345..1506 293..454 810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RI 2114 CG1725-RI 371..997 17..643 3135 100 Plus
dlg1-RJ 2102 CG1725-RJ 359..985 17..643 3135 100 Plus
dlg1-RC 2554 CG1725-RC 811..1437 17..643 3135 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11387986..11388174 455..643 945 100 Plus
X 23542271 X 11387772..11387933 293..454 810 100 Plus
X 23542271 X 11376840..11376973 34..167 670 100 Plus
X 23542271 X 11381854..11381980 166..292 635 100 Plus
Blast to na_te.dros performed 2015-02-11 17:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2285..2538 328..584 222 57.7 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 549..634 530..614 130 62.8 Plus
rover 7318 rover ROVER 7318bp 1930..1997 545..612 123 68.1 Plus

BS08448.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 09:40:53 Download gff for BS08448.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1725-PI 1..627 17..643 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 10:40:05 Download gff for BS08448.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1725-PJ 1..627 17..643 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 14:20:02 Download gff for BS08448.5prime
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 804..1440 8..650 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:15:35 Download gff for BS08448.5prime
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 804..1440 8..650 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:15:35 Download gff for BS08448.5prime
Subject Subject Range Query Range Percent Splice Strand
X 11376842..11376973 36..167 100 -> Plus
X 11381856..11381980 168..292 100 -> Plus
X 11387772..11387933 293..454 100 -> Plus
X 11387986..11388177 455..650 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 14:20:02 Download gff for BS08448.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11270875..11271006 36..167 100 -> Plus
arm_X 11275889..11276013 168..292 100 -> Plus
arm_X 11281805..11281966 293..454 100 -> Plus
arm_X 11282019..11282210 455..650 97   Plus

BS08448.complete Sequence

659 bp (659 high quality bases) assembled on 2006-01-18

GenBank Submission: FJ636160

> BS08448.complete
GAAGTTATCAGTCGACATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTC
TCGAGCTGCTCGAGGACTACCACGCGAGACTTTCGGAGCCGCAGGATCGG
GCGCTGCGTATTGCAATCGAACGCGTTATACGCATATTTAAATCTCGCTT
GTTTCAAGCGCTGTTAGATATACAAGAATTCTATGAATTGACATTATTGG
ATGACTCGAAGAGCATACAACAAAAGACAGCGGAGACCTTGCAAATTGCA
ACCAAATGGGAAAAGGATGGCCAGGCAGTCAAAATAGCTGATAATCAGCG
CATGCGCATCGAATCGGACACGGAAAATGCCAAGGAGCCAACTGTCGAGC
AGCAGCAAAAGCAGCAGCAAGCGCAGCAGCGCAGTTCCCGCTCCCCGCAG
CAGCAGAATCCGCAGCAGCAGCAGGGATCCAAATCGAGGAGCGGGTCCCA
GACTTCACAGATACAGATACAGTCACTTACACAGACATACCCAAACGCAC
ACCAGCGCAAGCGAGTCCTCGTGAGCCTCCATCCACATCAACATCAACAT
CAAAGCCAAATTCAACACCAACACCATTACCAACTTCGCCATAACAACGG
CATTCAAGCCAAAATGCTTAAGCGCGCTTTTGAGTCCACCTAGAAGCTTT
CTAGACCAT

BS08448.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RI 627 CG1725-PI 1..627 17..643 3135 100 Plus
dlg1-RJ 627 CG1725-PJ 1..627 17..643 3135 100 Plus
dlg1-RC 627 CG1725-PC 1..627 17..643 3135 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RI 2114 CG1725-RI 371..997 17..643 3135 100 Plus
dlg1-RJ 2102 CG1725-RJ 359..985 17..643 3135 100 Plus
dlg1-RC 2554 CG1725-RC 811..1437 17..643 3135 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11387986..11388174 455..643 945 100 Plus
X 23542271 X 11387772..11387933 293..454 810 100 Plus
X 23542271 X 11376840..11376973 34..167 670 100 Plus
X 23542271 X 11381854..11381980 166..292 635 100 Plus
Blast to na_te.dros performed 2014-11-28 07:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2285..2538 328..584 222 57.7 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 549..634 530..614 130 62.8 Plus
rover 7318 rover ROVER 7318bp 1930..1997 545..612 123 68.1 Plus

BS08448.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:03:22 Download gff for BS08448.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 1..627 17..643 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:38:02 Download gff for BS08448.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 399..1025 17..643 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:28 Download gff for BS08448.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 811..1437 17..643 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:03:22 Download gff for BS08448.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 392..1028 8..650 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:06:19 Download gff for BS08448.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 811..1437 17..643 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:06:19 Download gff for BS08448.complete
Subject Subject Range Query Range Percent Splice Strand
X 11374492..11374510 17..35 100 -> Plus
X 11376842..11376973 36..167 100 -> Plus
X 11381856..11381980 168..292 100 -> Plus
X 11387772..11387933 293..454 100 -> Plus
X 11387986..11388174 455..643 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:28 Download gff for BS08448.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11275889..11276013 168..292 100 -> Plus
arm_X 11281805..11281966 293..454 100 -> Plus
arm_X 11282019..11282207 455..643 100   Plus
arm_X 11268525..11268543 17..35 100 -> Plus
arm_X 11270875..11271006 36..167 100 -> Plus

BS08448.pep Sequence

Translation from 16 to 642

> BS08448.pep
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQAQQRSSRSPQQQNPQQQQGSKSRSGSQTSQIQ
IQSLTQTYPNAHQRKRVLVSLHPHQHQHQSQIQHQHHYQLRHNNGIQAKM
LKRAFEST*

BS08448.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-PI 208 CG1725-PI 1..208 1..208 1055 100 Plus
dlg1-PJ 208 CG1725-PJ 1..208 1..208 1055 100 Plus
dlg1-PC 208 CG1725-PC 1..208 1..208 1055 100 Plus
dlg1-PO 206 CG1725-PO 1..206 1..208 1033 99 Plus
dlg1-PU 198 CG1725-PU 1..198 1..208 989 95.2 Plus