Clone BS08643 Report

Search the DGRC for BS08643

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:86
Well:43
Vector:pDNR-Dual
Associated Gene/Transcriptsar1-RB
Protein status:BS08643.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS08643.3prime Sequence

498 bp (497 high quality bases) assembled on 2006-01-11

> BS08643.3prime
ATGGTCTAGAAAGCTTTTAATCGATATACTGCGCCAGCCAACGGAAACCC
TCGCCGTAGCCCTGTCGCTTCAGCACGGAGCACATGAACAATTCCAGAGG
ACGGCCGGGCAAATCGGCGCGTGCAACTTTGCCCTTGCCGGTTGTTAGCT
GATACAGTCCGAACACGTTTCTCAGCTCATCCTCGCTAGCCGCGCCGGGC
TTATCGATTTTGTTGCCCAATATGAGCACGGGGCAGTTGGACAGCGCCTC
ATCCGTGAGCAGCGAATCCAGCTCGTTTTTGCTCTCCTGGAAGCGGCCAC
GGTCCCAGGCGTCTATTAAGAAAACGATGGCGTCCACAGCAGGGAAGTAG
TCCTTCCAGACGCGTCGTGCCTGAGTGTGGCCACCCAAGTCGAATGTAGT
GAAGCGCATGTTGCCGATGGACAGCTCCTCGGATGTTGGATGCAGTGTGG
GCACATGCTGCGCCAGCTTATCATCTTTGAGCATGTCGACTGATAACT

BS08643.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 18:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG7073-PA 582 sar1-RA 115..582 484..17 2340 100 Minus
CG7073-PB 468 sar1-RB 1..468 484..17 2340 100 Minus
CG7073-PD 582 sar1-RD 115..582 484..17 2340 100 Minus
CG7073-PC 582 sar1-RC 115..582 484..17 2340 100 Minus
CG7073-PE 582 sar1-RE 115..582 484..17 2340 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-01 07:03:17
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-RE 1452 CG7073-RE 227..694 484..17 2340 100 Minus
Sar1-RC 1801 CG7073-RC 576..1043 484..17 2340 100 Minus
Sar1-RD 1552 CG7073-RD 327..794 484..17 2340 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-01 07:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22359524..22359761 370..133 1190 100 Minus
3R 32079331 3R 22359835..22359953 135..17 595 100 Minus
3R 32079331 3R 22358563..22358628 435..370 330 100 Minus
3R 32079331 3R 22358443..22358491 484..436 245 100 Minus
Blast to na_te.dros performed on 2015-02-01 07:03:14 has no hits.

BS08643.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 09:46:12 Download gff for BS08643.3prime
Subject Subject Range Query Range Percent Splice Strand
sar1-PA 115..582 17..484 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 10:47:39 Download gff for BS08643.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7073-PE 115..582 17..484 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-07 15:10:18 Download gff for BS08643.3prime
Subject Subject Range Query Range Percent Splice Strand
Sar1-RA 278..745 17..484 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-01 09:40:34 Download gff for BS08643.3prime
Subject Subject Range Query Range Percent Splice Strand
Sar1-RD 327..794 17..484 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-01 09:40:34 Download gff for BS08643.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 22358443..22358491 436..484 100 -> Minus
3R 22358563..22358628 370..435 100 -> Minus
3R 22359525..22359760 134..369 100 -> Minus
3R 22359837..22359953 17..133 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-07 15:10:18 Download gff for BS08643.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18184165..18184213 436..484 100 -> Minus
arm_3R 18184285..18184350 370..435 100 -> Minus
arm_3R 18185247..18185482 134..369 100 -> Minus
arm_3R 18185559..18185675 17..133 100   Minus

BS08643.5prime Sequence

498 bp (497 high quality bases) assembled on 2006-01-11

> BS08643.5prime
GAAGTTATCAGTCGACATGCTCAAAGATGATAAGCTGGCGCAGCATGTGC
CCACACTGCATCCAACATCCGAGGAGCTGTCCATCGGCAACATGCGCTTC
ACTACATTCGACTTGGGTGGCCACACTCAGGCACGACGCGTCTGGAAGGA
CTACTTCCCTGCTGTGGACGCCATCGTTTTCTTAATAGACGCCTGGGACC
GTGGCCGCTTCCAGGAGAGCAAAAACGAGCTGGATTCGCTGCTCACGGAT
GAGGCGCTGTCCAACTGCCCCGTGCTCATATTGGGCAACAAAATCGATAA
GCCCGGCGCGGCTAGCGAGGATGAGCTGAGAAACGTGTTCGGACTGTATC
AGCTAACAACCGGCAAGGGCAAAGTTGCACGCGCCGATTTGCCCGGCCGT
CCTCTGGAATTGTTCATGTGCTCCGTGCTGAAGCGACAGGGCTACGGCGA
GGGTTTCCGTTGGCTGGCGCAGTATATCGATTAAAAGCTTTCTAGACC

BS08643.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 18:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG7073-PA 582 sar1-RA 115..582 17..484 2340 100 Plus
CG7073-PB 468 sar1-RB 1..468 17..484 2340 100 Plus
CG7073-PD 582 sar1-RD 115..582 17..484 2340 100 Plus
CG7073-PC 582 sar1-RC 115..582 17..484 2340 100 Plus
CG7073-PE 582 sar1-RE 115..582 17..484 2340 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-RE 1452 CG7073-RE 227..694 17..484 2340 100 Plus
Sar1-RC 1801 CG7073-RC 576..1043 17..484 2340 100 Plus
Sar1-RD 1552 CG7073-RD 327..794 17..484 2340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 14:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22359524..22359761 131..368 1190 100 Plus
3R 32079331 3R 22359835..22359953 366..484 595 100 Plus
3R 32079331 3R 22358563..22358628 66..131 330 100 Plus
3R 32079331 3R 22358443..22358491 17..65 245 100 Plus
Blast to na_te.dros performed on 2015-02-13 14:13:24 has no hits.

BS08643.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 09:46:13 Download gff for BS08643.5prime
Subject Subject Range Query Range Percent Splice Strand
sar1-PA 115..582 17..484 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 10:47:41 Download gff for BS08643.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7073-PE 115..582 17..484 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 03:03:06 Download gff for BS08643.5prime
Subject Subject Range Query Range Percent Splice Strand
Sar1-RA 278..745 17..484 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:00:23 Download gff for BS08643.5prime
Subject Subject Range Query Range Percent Splice Strand
Sar1-RD 327..794 17..484 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:00:23 Download gff for BS08643.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 22358443..22358491 17..65 100 -> Plus
3R 22358563..22358628 66..131 100 -> Plus
3R 22359525..22359760 132..367 100 -> Plus
3R 22359837..22359953 368..484 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 03:03:06 Download gff for BS08643.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18184165..18184213 17..65 100 -> Plus
arm_3R 18184285..18184350 66..131 100 -> Plus
arm_3R 18185247..18185482 132..367 100 -> Plus
arm_3R 18185559..18185675 368..484 100   Plus

BS08643.complete Sequence

500 bp (500 high quality bases) assembled on 2006-01-25

GenBank Submission: FJ636219

> BS08643.complete
GAAGTTATCAGTCGACATGCTCAAAGATGATAAGCTGGCGCAGCATGTGC
CCACACTGCATCCAACATCCGAGGAGCTGTCCATCGGCAACATGCGCTTC
ACTACATTCGACTTGGGTGGCCACACTCAGGCACGACGCGTCTGGAAGGA
CTACTTCCCTGCTGTGGACGCCATCGTTTTCTTAATAGACGCCTGGGACC
GTGGCCGCTTCCAGGAGAGCAAAAACGAGCTGGATTCGCTGCTCACGGAT
GAGGCGCTGTCCAACTGCCCCGTGCTCATATTGGGCAACAAAATCGATAA
GCCCGGCGCGGCTAGCGAGGATGAGCTGAGAAACGTGTTCGGACTGTATC
AGCTAACAACCGGCAAGGGCAAAGTTGCACGCGCCGATTTGCCCGGCCGT
CCTCTGGAATTGTTCATGTGCTCCGTGCTGAAGCGACAGGGCTACGGCGA
GGGTTTCCGTTGGCTGGCGCAGTATATCGATTAAAAGCTTTCTAGACCAT

BS08643.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-RE 582 CG7073-PE 115..582 17..484 2340 100 Plus
Sar1-RC 582 CG7073-PC 115..582 17..484 2340 100 Plus
Sar1-RD 582 CG7073-PD 115..582 17..484 2340 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-RE 1452 CG7073-RE 227..694 17..484 2340 100 Plus
Sar1-RC 1801 CG7073-RC 576..1043 17..484 2340 100 Plus
Sar1-RD 1552 CG7073-RD 327..794 17..484 2340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22359524..22359761 131..368 1190 100 Plus
3R 32079331 3R 22359835..22359953 366..484 595 100 Plus
3R 32079331 3R 22358563..22358628 66..131 330 100 Plus
3R 32079331 3R 22358443..22358491 17..65 245 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:40:07 has no hits.

BS08643.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:48:35 Download gff for BS08643.complete
Subject Subject Range Query Range Percent Splice Strand
sar1-RD 115..582 17..484 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:36:43 Download gff for BS08643.complete
Subject Subject Range Query Range Percent Splice Strand
sar1-RD 391..858 17..484 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:33:06 Download gff for BS08643.complete
Subject Subject Range Query Range Percent Splice Strand
Sar1-RA 278..743 17..482 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:48:35 Download gff for BS08643.complete
Subject Subject Range Query Range Percent Splice Strand
sar1-RD 391..858 17..484 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:07 Download gff for BS08643.complete
Subject Subject Range Query Range Percent Splice Strand
Sar1-RD 327..792 17..482 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:07 Download gff for BS08643.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22359525..22359760 132..367 100 -> Plus
3R 22359837..22359951 368..482 100   Plus
3R 22358443..22358491 17..65 100 -> Plus
3R 22358563..22358628 66..131 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:33:06 Download gff for BS08643.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18185247..18185482 132..367 100 -> Plus
arm_3R 18184165..18184213 17..65 100 -> Plus
arm_3R 18184285..18184350 66..131 100 -> Plus
arm_3R 18185559..18185673 368..482 100   Plus

BS08643.pep Sequence

Translation from 16 to 483

> BS08643.pep
MLKDDKLAQHVPTLHPTSEELSIGNMRFTTFDLGGHTQARRVWKDYFPAV
DAIVFLIDAWDRGRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAAS
EDELRNVFGLYQLTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWL
AQYID*

BS08643.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Sar1-PE 193 CG7073-PE 39..193 1..155 819 100 Plus
Sar1-PC 193 CG7073-PC 39..193 1..155 819 100 Plus
Sar1-PD 193 CG7073-PD 39..193 1..155 819 100 Plus
Sar1-PA 193 CG7073-PA 39..193 1..155 819 100 Plus
Arl1-PA 180 CG6025-PA 45..173 11..151 200 30.5 Plus