Clone Sequence Records
BS09189.3prime Sequence
354 bp (353 high quality bases) assembled on 2006-01-24
> BS09189.3prime
ATGGTCTAGAAAGCTTTTACTGATCGTTCTCGAAGTACGGCGGCGAATTG
GTGCGATCGGGCAGAAAGAACGCCAATTGGACCGTGGAGGCCAGTGCGGG
CGGCTCGTCACGACCCACCTTAACCTCTTCCGCAATTACGGTGAGCAGCA
CCGGATCACCCACATGCGTGATGAAGGCAATGTCCTCGAGGGGTCGCATC
AGGAAGATCTCGCCTGTAATGCAAATAGCCGAAGCGTTGATTGATTTAAT
GCACAGGTTGGAAGGGTAAGCTATATTTAAGATTAATTGCATGGAGTTCC
TGAAAATTAATACAACGTAAAATAATCCTAAAGAGTCCATGTCGACTGAT
AACT
BS09189.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 18:22:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4655-PB | 324 | CG4655-RB | 1..324 | 340..17 | 1595 | 99.6 | Minus |
CG4655-PA | 1512 | CG4655-RA | 1315..1512 | 214..17 | 990 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:50:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Cad86C-RG | 7212 | CG42601-RG | 2187..2380 | 214..21 | 970 | 100 | Minus |
Cad86C-RF | 6665 | CG42601-RF | 1531..1724 | 214..21 | 970 | 100 | Minus |
Cad86C-RE | 6563 | CG42601-RE | 1447..1640 | 214..21 | 970 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:50:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 10841665..10841988 | 340..17 | 1605 | 99.7 | Minus |
Blast to na_te.dros performed 2015-02-02 18:50:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbuz\Osvaldo | 9045 | Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). | 5195..5231 | 178..142 | 104 | 75.7 | Minus |
BS09189.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:02:06 Download gff for
BS09189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4655-PB | 1..324 | 17..340 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 11:09:32 Download gff for
BS09189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4655-PB | 1..324 | 17..340 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 17:32:25 Download gff for
BS09189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Cad86C-RE | 1442..1643 | 18..221 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 20:55:10 Download gff for
BS09189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Cad86C-RE | 1442..1643 | 18..221 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 20:55:10 Download gff for
BS09189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10841665..10841988 | 17..340 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 17:32:25 Download gff for
BS09189.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 6667387..6667710 | 17..340 | 99 | | Minus |
BS09189.5prime Sequence
354 bp (353 high quality bases) assembled on 2006-01-24
> BS09189.5prime
GAAGTTATCAGTCGACATGGACTCTTTAGGATTATTTTACGTTGTATTAA
TTTTCAGGAACTCCATGCAATTAATCTTAAATATAGCTTACCCTTCCAAC
CTGTGCATTAAATCAATCAACGCTTCGGCTATTTGCATTACAGGCGAGAT
CTTCCTGATGCGACCCCTCGAGGACATTGCCTTCATCACGCATGTGGGTG
ATCCGGTGCTGCTCACCGTAATTGCGGAAGAGGTTAAGGTGGGTCGTGAC
GAGCCGCCCGCACTGGCCTCCACGGTCCAATTGGCGTTCTTTCTGCCCGA
TCGCACCAATTCGCCGCCGTACTTCGAGAACGATCAGTAAAAGCTTTCTA
GACC
BS09189.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 18:22:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4655-PB | 324 | CG4655-RB | 1..324 | 17..340 | 1595 | 99.6 | Plus |
CG4655-PA | 1512 | CG4655-RA | 1315..1512 | 143..340 | 990 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:13:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Cad86C-RG | 7212 | CG42601-RG | 2187..2380 | 143..336 | 970 | 100 | Plus |
Cad86C-RF | 6665 | CG42601-RF | 1531..1724 | 143..336 | 970 | 100 | Plus |
Cad86C-RE | 6563 | CG42601-RE | 1447..1640 | 143..336 | 970 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 11:13:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 10841665..10841988 | 17..340 | 1605 | 99.7 | Plus |
Blast to na_te.dros performed 2015-02-11 11:13:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbuz\Osvaldo | 9045 | Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). | 5195..5231 | 179..215 | 104 | 75.7 | Plus |
BS09189.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:02:07 Download gff for
BS09189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4655-PB | 1..324 | 17..340 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 11:09:34 Download gff for
BS09189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4655-PB | 1..324 | 17..340 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 15:06:37 Download gff for
BS09189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Cad86C-RE | 1442..1643 | 136..339 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:43:04 Download gff for
BS09189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Cad86C-RE | 1442..1643 | 136..339 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:43:04 Download gff for
BS09189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10841665..10841988 | 17..340 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 15:06:37 Download gff for
BS09189.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 6667387..6667710 | 17..340 | 99 | | Plus |
BS09189.complete Sequence
356 bp assembled on 2008-08-15
> BS09189.complete
GAAGTTATCAGTCGACATGGACTCTTTAGGATTATTTTACGTTGTATTAA
TTTTCAGGAACTCCATGCAATTAATCTTAAATATAGCTTACCCTTCCAAC
CTGTGCATTAAATCAATCAACGCTTCGGCTATTTGCATTACAGGCGAGAT
CTTCCTGATGCGACCCCTCGAGGACATTGCCTTCATCACGCATGTGGGTG
ATCCGGTGCTGCTCACCGTAATTGCGGAAGAGGTTAAGGTGGGTCGTGAC
GAGCCGCCCGCACTGGCCTCCACGGTCCAATTGGCGTTCTTTCTGCCCGA
TCGCACCAATTCGCCGCCGTACTTCGAGAACGATCAGTAAAAGCTTTCTA
GACCAT
BS09189.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:11:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Cad86C-RG | 3027 | CG42601-PG | 1267..1460 | 143..336 | 970 | 100 | Plus |
Cad86C-RF | 5850 | CG42601-PF | 1267..1460 | 143..336 | 970 | 100 | Plus |
Cad86C-RE | 5748 | CG42601-PE | 1183..1376 | 143..336 | 970 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:11:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Cad86C-RG | 7212 | CG42601-RG | 2187..2380 | 143..336 | 970 | 100 | Plus |
Cad86C-RF | 6665 | CG42601-RF | 1531..1724 | 143..336 | 970 | 100 | Plus |
Cad86C-RE | 6563 | CG42601-RE | 1447..1640 | 143..336 | 970 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:11:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 10841665..10841988 | 17..340 | 1605 | 99.7 | Plus |
Blast to na_te.dros performed 2014-11-27 15:11:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbuz\Osvaldo | 9045 | Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). | 5195..5231 | 179..215 | 104 | 75.7 | Plus |
BS09189.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:54:27 Download gff for
BS09189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4655-RA | 1310..1512 | 136..340 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:47 Download gff for
BS09189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Cad86C-RE | 1442..1642 | 136..338 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:02:09 Download gff for
BS09189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4655-RA | 1310..1510 | 136..338 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:06 Download gff for
BS09189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Cad86C-RE | 1442..1642 | 136..338 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:02:06 Download gff for
BS09189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10841665..10841986 | 17..338 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:47 Download gff for
BS09189.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 6667387..6667708 | 17..338 | 99 | | Plus |
BS09189.pep Sequence
Translation from 16 to 339
> BS09189.pep
MDSLGLFYVVLIFRNSMQLILNIAYPSNLCIKSINASAICITGEIFLMRP
LEDIAFITHVGDPVLLTVIAEEVKVGRDEPPALASTVQLAFFLPDRTNSP
PYFENDQ*
BS09189.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:42:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Cad86C-PG | 1008 | CG42601-PG | 422..486 | 42..106 | 331 | 98.5 | Plus |
Cad86C-PE | 1915 | CG42601-PE | 394..458 | 42..106 | 331 | 98.5 | Plus |
Cad86C-PD | 1943 | CG42601-PD | 422..486 | 42..106 | 331 | 98.5 | Plus |
Cad86C-PC | 1943 | CG42601-PC | 422..486 | 42..106 | 331 | 98.5 | Plus |
Cad86C-PF | 1949 | CG42601-PF | 422..486 | 42..106 | 331 | 98.5 | Plus |