Clone Sequence Records
BS11063.5prime Sequence
246 bp (245 high quality bases) assembled on 2006-04-19
> BS11063.5prime
GAAGTTATCAGTCGACATGAAATTCTTCAACCTGCTGTTTAGCCTCTGTC
TGGCCTTCATGCTGTGCACCTCGTGGGTGTCGGCTTTCTCCAGTCTTGCC
ACCCCGGAGCCAACTCCGCCAACTGGTGCTCCCGTCGATGGTACGACTAG
CACGGGATTCTCTGGTCCGCCGCAGGCTGAGACCACAAATGCCACGCCAG
AAACGTCGACCATCTATCCCATTTACGGATAGAAGCTTTCTAGACC
BS11063.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-PA | 216 | CG14302-RA | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:13:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-RA | 281 | CG14302-RA | 20..241 | 11..232 | 1095 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:12:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18732786..18732994 | 24..232 | 1045 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 05:12:56 has no hits.
BS11063.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:35 Download gff for
BS11063.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-PA | 1..216 | 17..232 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:30 Download gff for
BS11063.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-PA | 1..216 | 17..232 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 03:56:42 Download gff for
BS11063.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..221 | 12..232 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:32:45 Download gff for
BS11063.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 20..241 | 11..232 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:32:45 Download gff for
BS11063.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18732781..18732994 | 18..232 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 03:56:42 Download gff for
BS11063.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14558503..14558716 | 18..232 | 98 | | Plus |
BS11063.3prime Sequence
246 bp (245 high quality bases) assembled on 2006-04-19
> BS11063.3prime
ATGGTCTAGAAAGCTTCTATCCGTAAATGGGATAGATGGTCGACGTTTCT
GGCGTGGCATTTGTGGTCTCAGCCTGCGGCGGACCAGAGAATCCCGTGCT
AGTCGTACCATCGACGGGAGCACCAGTTGGCGGAGTTGGCTCCGGGGTGG
CAAGACTGGAGAAAGCCGACACCCACGAGGTGCACAGCATGAAGGCCAGA
CAGAGGCTAAACAGCAGGTTGAAGAATTTCATGTCGACTGATAACT
BS11063.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-PA | 216 | CG14302-RA | 1..216 | 232..17 | 1080 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:27:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-RA | 281 | CG14302-RA | 20..241 | 238..17 | 1095 | 99.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:27:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18732786..18732994 | 225..17 | 1045 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 04:27:45 has no hits.
BS11063.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:33 Download gff for
BS11063.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-PA | 1..216 | 17..232 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:28 Download gff for
BS11063.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-PA | 1..216 | 17..232 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 23:26:15 Download gff for
BS11063.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..221 | 17..237 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:06:44 Download gff for
BS11063.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 20..241 | 17..238 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:06:44 Download gff for
BS11063.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18732781..18732994 | 17..231 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 23:26:15 Download gff for
BS11063.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14558503..14558716 | 17..231 | 98 | | Minus |
BS11063.complete Sequence
248 bp assembled on 2006-11-01
GenBank Submission: FJ636754
> BS11063.complete
GAAGTTATCAGTCGACATGAAATTCTTCAACCTGCTGTTTAGCCTCTGTC
TGGCCTTCATGCTGTGCACCTCGTGGGTGTCGGCTTTCTCCAGTCTTGCC
ACCCCGGAGCCAACTCCGCCAACTGGTGCTCCCGTCGATGGTACGACTAG
CACGGGATTCTCTGGTCCGCCGCAGGCTGAGACCACAAATGCCACGCCAG
AAACGTCGACCATCTATCCCATTTACGGATAGAAGCTTTCTAGACCAT
BS11063.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:11:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-RA | 216 | CG14302-PA | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:11:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-RA | 281 | CG14302-RA | 20..241 | 11..232 | 1095 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:10:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 18732786..18732994 | 24..232 | 1045 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 15:11:00 has no hits.
BS11063.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:52:39 Download gff for
BS11063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..216 | 17..232 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:55:32 Download gff for
BS11063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..221 | 12..232 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:38:15 Download gff for
BS11063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 6..221 | 17..232 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:52:40 Download gff for
BS11063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 1..221 | 12..232 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:47 Download gff for
BS11063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14302-RA | 26..241 | 17..232 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:01:47 Download gff for
BS11063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 18732780..18732994 | 17..232 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:38:15 Download gff for
BS11063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 14558502..14558716 | 17..232 | 98 | | Plus |
BS11063.pep Sequence
Translation from 16 to 231
> BS11063.pep
MKFFNLLFSLCLAFMLCTSWVSAFSSLATPEPTPPTGAPVDGTTSTGFSG
PPQAETTNATPETSTIYPIYG*
BS11063.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14302-PA | 71 | CG14302-PA | 1..71 | 1..71 | 381 | 100 | Plus |