Clone BS11064 Report

Search the DGRC for BS11064

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:110
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG18628-RA
Protein status:BS11064.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11064.3prime Sequence

222 bp (221 high quality bases) assembled on 2006-04-19

> BS11064.3prime
ATGGTCTAGAAAGCTTCTAGCCGCAGCAGGCGACGTCATCGTGCTTGTGC
TGAGCCTGAACGTCCTCGGCGAAGTGAACGCTGCGGACCACCGGGTGGTG
GTGATGGTCATCGCCAACCATGGGGGCCTCGTTGTTCAGTTGGGGAAGGG
CAGAGGCCATGAAGAAGGCGAGGCCCAGGATGAGAGTGCACACGAGTAGG
AACTTCATGTCGACTGATAACT

BS11064.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-PA 192 CG18628-RA 1..192 208..17 960 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 01:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-RA 334 CG18628-RA 59..252 209..16 970 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 01:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10639919..10640054 151..16 680 100 Minus
3L 28110227 3L 10639798..10639856 209..151 295 100 Minus
Blast to na_te.dros performed on 2015-02-11 01:14:53 has no hits.

BS11064.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:36 Download gff for BS11064.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18628-PA 1..192 17..208 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:32 Download gff for BS11064.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18628-PA 1..192 17..208 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 15:12:03 Download gff for BS11064.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 50..257 8..216 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:32:57 Download gff for BS11064.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 50..257 8..216 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 04:32:57 Download gff for BS11064.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 10639789..10639856 151..216 94 -> Minus
3L 10639920..10640059 8..150 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 15:12:03 Download gff for BS11064.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10632889..10632956 151..216 94 -> Minus
arm_3L 10633020..10633159 8..150 97   Minus

BS11064.5prime Sequence

222 bp (221 high quality bases) assembled on 2006-04-19

> BS11064.5prime
GAAGTTATCAGTCGACATGAAGTTCCTACTCGTGTGCACTCTCATCCTGG
GCCTCGCCTTCTTCATGGCCTCTGCCCTTCCCCAACTGAACAACGAGGCC
CCCATGGTTGGCGATGACCATCACCACCACCCGGTGGTCCGCAGCGTTCA
CTTCGCCGAGGACGTTCAGGCTCAGCACAAGCACGATGACGTCGCCTGCT
GCGGCTAGAAGCTTTCTAGACC

BS11064.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-PA 192 CG18628-RA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-RA 334 CG18628-RA 59..252 16..209 970 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10639919..10640054 74..209 680 100 Plus
3L 28110227 3L 10639798..10639856 16..74 295 100 Plus
Blast to na_te.dros performed on 2015-02-13 09:29:53 has no hits.

BS11064.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:37 Download gff for BS11064.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18628-PA 1..192 17..208 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:33 Download gff for BS11064.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18628-PA 1..192 17..208 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 15:55:28 Download gff for BS11064.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 50..257 9..217 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:01:16 Download gff for BS11064.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 50..257 9..217 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:01:16 Download gff for BS11064.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 10639920..10640059 75..217 97   Plus
3L 10639789..10639856 9..74 94 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 15:55:28 Download gff for BS11064.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10632889..10632956 9..74 94 -> Plus
arm_3L 10633020..10633159 75..217 97   Plus

BS11064.complete Sequence

224 bp assembled on 2006-11-01

GenBank Submission: FJ636755

> BS11064.complete
GAAGTTATCAGTCGACATGAAGTTCCTACTCGTGTGCACTCTCATCCTGG
GCCTCGCCTTCTTCATGGCCTCTGCCCTTCCCCAACTGAACAACGAGGCC
CCCATGGTTGGCGATGACCATCACCACCACCCGGTGGTCCGCAGCGTTCA
CTTCGCCGAGGACGTTCAGGCTCAGCACAAGCACGATGACGTCGCCTGCT
GCGGCTAGAAGCTTTCTAGACCAT

BS11064.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-RA 192 CG18628-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-RA 334 CG18628-RA 59..252 16..209 970 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10639919..10640054 74..209 680 100 Plus
3L 28110227 3L 10639798..10639856 16..74 295 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:26:45 has no hits.

BS11064.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:52:40 Download gff for BS11064.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 1..192 17..208 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:28:05 Download gff for BS11064.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 19..226 9..217 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:10:28 Download gff for BS11064.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 60..251 17..208 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:52:41 Download gff for BS11064.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 19..226 9..217 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:22:01 Download gff for BS11064.complete
Subject Subject Range Query Range Percent Splice Strand
CG18628-RA 60..251 17..208 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:22:01 Download gff for BS11064.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10639799..10639856 17..74 100 -> Plus
3L 10639920..10640053 75..208 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:10:28 Download gff for BS11064.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10632899..10632956 17..74 100 -> Plus
arm_3L 10633020..10633153 75..208 100   Plus

BS11064.pep Sequence

Translation from 16 to 207

> BS11064.pep
MKFLLVCTLILGLAFFMASALPQLNNEAPMVGDDHHHHPVVRSVHFAEDV
QAQHKHDDVACCG*

BS11064.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG18628-PA 63 CG18628-PA 1..63 1..63 344 100 Plus