Clone Sequence Records
BS11064.3prime Sequence
222 bp (221 high quality bases) assembled on 2006-04-19
> BS11064.3prime
ATGGTCTAGAAAGCTTCTAGCCGCAGCAGGCGACGTCATCGTGCTTGTGC
TGAGCCTGAACGTCCTCGGCGAAGTGAACGCTGCGGACCACCGGGTGGTG
GTGATGGTCATCGCCAACCATGGGGGCCTCGTTGTTCAGTTGGGGAAGGG
CAGAGGCCATGAAGAAGGCGAGGCCCAGGATGAGAGTGCACACGAGTAGG
AACTTCATGTCGACTGATAACT
BS11064.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-PA | 192 | CG18628-RA | 1..192 | 208..17 | 960 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 01:14:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-RA | 334 | CG18628-RA | 59..252 | 209..16 | 970 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 01:14:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 10639919..10640054 | 151..16 | 680 | 100 | Minus |
3L | 28110227 | 3L | 10639798..10639856 | 209..151 | 295 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 01:14:53 has no hits.
BS11064.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:36 Download gff for
BS11064.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-PA | 1..192 | 17..208 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:32 Download gff for
BS11064.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-PA | 1..192 | 17..208 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 15:12:03 Download gff for
BS11064.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 50..257 | 8..216 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:32:57 Download gff for
BS11064.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 50..257 | 8..216 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 04:32:57 Download gff for
BS11064.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 10639789..10639856 | 151..216 | 94 | -> | Minus |
3L | 10639920..10640059 | 8..150 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 15:12:03 Download gff for
BS11064.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 10632889..10632956 | 151..216 | 94 | -> | Minus |
arm_3L | 10633020..10633159 | 8..150 | 97 | | Minus |
BS11064.5prime Sequence
222 bp (221 high quality bases) assembled on 2006-04-19
> BS11064.5prime
GAAGTTATCAGTCGACATGAAGTTCCTACTCGTGTGCACTCTCATCCTGG
GCCTCGCCTTCTTCATGGCCTCTGCCCTTCCCCAACTGAACAACGAGGCC
CCCATGGTTGGCGATGACCATCACCACCACCCGGTGGTCCGCAGCGTTCA
CTTCGCCGAGGACGTTCAGGCTCAGCACAAGCACGATGACGTCGCCTGCT
GCGGCTAGAAGCTTTCTAGACC
BS11064.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-PA | 192 | CG18628-RA | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:29:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-RA | 334 | CG18628-RA | 59..252 | 16..209 | 970 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:29:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 10639919..10640054 | 74..209 | 680 | 100 | Plus |
3L | 28110227 | 3L | 10639798..10639856 | 16..74 | 295 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-13 09:29:53 has no hits.
BS11064.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:37 Download gff for
BS11064.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-PA | 1..192 | 17..208 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:33 Download gff for
BS11064.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-PA | 1..192 | 17..208 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 15:55:28 Download gff for
BS11064.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 50..257 | 9..217 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:01:16 Download gff for
BS11064.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 50..257 | 9..217 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:01:16 Download gff for
BS11064.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 10639920..10640059 | 75..217 | 97 | | Plus |
3L | 10639789..10639856 | 9..74 | 94 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 15:55:28 Download gff for
BS11064.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 10632889..10632956 | 9..74 | 94 | -> | Plus |
arm_3L | 10633020..10633159 | 75..217 | 97 | | Plus |
BS11064.complete Sequence
224 bp assembled on 2006-11-01
GenBank Submission: FJ636755
> BS11064.complete
GAAGTTATCAGTCGACATGAAGTTCCTACTCGTGTGCACTCTCATCCTGG
GCCTCGCCTTCTTCATGGCCTCTGCCCTTCCCCAACTGAACAACGAGGCC
CCCATGGTTGGCGATGACCATCACCACCACCCGGTGGTCCGCAGCGTTCA
CTTCGCCGAGGACGTTCAGGCTCAGCACAAGCACGATGACGTCGCCTGCT
GCGGCTAGAAGCTTTCTAGACCAT
BS11064.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:26:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-RA | 192 | CG18628-PA | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:26:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-RA | 334 | CG18628-RA | 59..252 | 16..209 | 970 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:26:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 10639919..10640054 | 74..209 | 680 | 100 | Plus |
3L | 28110227 | 3L | 10639798..10639856 | 16..74 | 295 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 10:26:45 has no hits.
BS11064.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:52:40 Download gff for
BS11064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 1..192 | 17..208 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:28:05 Download gff for
BS11064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 19..226 | 9..217 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:10:28 Download gff for
BS11064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 60..251 | 17..208 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:52:41 Download gff for
BS11064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 19..226 | 9..217 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:22:01 Download gff for
BS11064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18628-RA | 60..251 | 17..208 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:22:01 Download gff for
BS11064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 10639799..10639856 | 17..74 | 100 | -> | Plus |
3L | 10639920..10640053 | 75..208 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:10:28 Download gff for
BS11064.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 10632899..10632956 | 17..74 | 100 | -> | Plus |
arm_3L | 10633020..10633153 | 75..208 | 100 | | Plus |
BS11064.pep Sequence
Translation from 16 to 207
> BS11064.pep
MKFLLVCTLILGLAFFMASALPQLNNEAPMVGDDHHHHPVVRSVHFAEDV
QAQHKHDDVACCG*
BS11064.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18628-PA | 63 | CG18628-PA | 1..63 | 1..63 | 344 | 100 | Plus |