Clone BS11067 Report

Search the DGRC for BS11067

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:110
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG13364-RA
Protein status:BS11067.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11067.3prime Sequence

225 bp (224 high quality bases) assembled on 2006-04-19

> BS11067.3prime
ATGGTCTAGAAAGCTTTCACTTCTTTCCCGACTTCTTGATGCCGCCTCCT
ACGAGAGGACCCTTCTTTGAGGCGTTCGCCTTGGCCGCCTCCAGAGCCTT
CTGCTGCTCCTTCTGCTTTTGCTTGAAGGCCATGTCGTCCTCGTCCAGGT
CTTTGGAGTCCTTCTTCGGCGCCTTCAGAGGCTTCTTCTTACCGCCCTCG
CGTCCAGACATGTCGACTGATAACT

BS11067.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-PA 195 CG13364-RA 1..195 211..17 975 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-RA 387 CG13364-RA 54..249 211..16 980 100 Minus
CG16824-RA 407 CG16824-RA 71..265 211..17 570 86.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 624895..625090 16..211 980 100 Plus
2L 23513712 2L 13293079..13293273 211..17 570 86.2 Minus
Blast to na_te.dros performed on 2015-02-10 15:56:41 has no hits.

BS11067.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:42 Download gff for BS11067.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-PA 1..195 17..211 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:40 Download gff for BS11067.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-PA 1..195 17..211 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-14 15:00:10 Download gff for BS11067.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..252 12..218 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:07:37 Download gff for BS11067.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..252 12..218 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:07:37 Download gff for BS11067.3prime
Subject Subject Range Query Range Percent Splice Strand
X 624892..625093 12..218 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-14 15:00:10 Download gff for BS11067.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 518925..519126 12..218 97   Plus

BS11067.5prime Sequence

225 bp (224 high quality bases) assembled on 2006-04-19

> BS11067.5prime
GAAGTTATCAGTCGACATGTCTGGACGCGAGGGCGGTAAGAAGAAGCCTC
TGAAGGCGCCGAAGAAGGACTCCAAAGACCTGGACGAGGACGACATGGCC
TTCAAGCAAAAGCAGAAGGAGCAGCAGAAGGCTCTGGAGGCGGCCAAGGC
GAACGCCTCAAAGAAGGGTCCTCTCGTAGGAGGCGGCATCAAGAAGTCGG
GAAAGAAGTGAAAGCTTTCTAGACC

BS11067.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-PA 195 CG13364-RA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-RA 387 CG13364-RA 54..249 17..212 980 100 Plus
CG16824-RA 407 CG16824-RA 71..265 17..211 570 86.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 14:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 624895..625090 212..17 980 100 Minus
2L 23513712 2L 13293079..13293273 17..211 570 86.2 Plus
Blast to na_te.dros performed on 2015-02-13 14:19:55 has no hits.

BS11067.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:43 Download gff for BS11067.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-PA 1..195 17..211 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:41 Download gff for BS11067.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-PA 1..195 17..211 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 03:04:44 Download gff for BS11067.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..252 10..216 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:14:35 Download gff for BS11067.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 47..252 10..216 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:14:35 Download gff for BS11067.5prime
Subject Subject Range Query Range Percent Splice Strand
X 624892..625093 10..216 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 03:04:44 Download gff for BS11067.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 518925..519126 10..216 97   Minus

BS11067.complete Sequence

227 bp assembled on 2006-11-01

GenBank Submission: FJ636756

> BS11067.complete
GAAGTTATCAGTCGACATGTCTGGACGCGAGGGCGGTAAGAAGAAGCCTC
TGAAGGCGCCGAAGAAGGACTCCAAAGACCTGGACGAGGACGACATGGCC
TTCAAGCAAAAGCAGAAGGAGCAGCAGAAGGCTCTGGAGGCGGCCAAGGC
GAACGCCTCAAAGAAGGGTCCTCTCGTAGGAGGCGGCATCAAGAAGTCGG
GAAAGAAGTGAAAGCTTTCTAGACCAT

BS11067.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-RA 195 CG13364-PA 1..195 17..211 975 100 Plus
CG16824-RA 195 CG16824-PA 1..195 17..211 570 86.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-RA 387 CG13364-RA 54..249 17..212 980 100 Plus
CG16824-RA 407 CG16824-RA 71..265 17..211 570 86.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 624895..625090 212..17 980 100 Minus
2L 23513712 2L 13293079..13293273 17..211 570 86.2 Plus
Blast to na_te.dros performed on 2014-11-27 08:37:38 has no hits.

BS11067.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:52:42 Download gff for BS11067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 1..195 17..211 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:28:07 Download gff for BS11067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 45..250 10..216 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:12:25 Download gff for BS11067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 54..247 17..210 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:52:42 Download gff for BS11067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 45..250 10..216 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:23:31 Download gff for BS11067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13364-RA 54..247 17..210 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:23:31 Download gff for BS11067.complete
Subject Subject Range Query Range Percent Splice Strand
X 624897..625090 17..210 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:12:25 Download gff for BS11067.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 518930..519123 17..210 100   Minus

BS11067.pep Sequence

Translation from 16 to 210

> BS11067.pep
MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKK
GPLVGGGIKKSGKK*

BS11067.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13364-PA 64 CG13364-PA 1..64 1..64 324 100 Plus
CG16824-PA 64 CG16824-PA 1..64 1..64 301 90.6 Plus