Clone BS11068 Report

Search the DGRC for BS11068

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:110
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG8860-RA
Protein status:BS11068.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11068.3prime Sequence

237 bp (236 high quality bases) assembled on 2006-04-19

> BS11068.3prime
ATGGTCTAGAAAGCTTCTAGGATCCCACGATGATGTTGTTAATGGGAATG
TGAATCAGCTTGACGAAGAAGCCGATGAAGCCCATGATGGCGAAGCCCAC
GGCGGTGGCGATGGCGATTTTCTGGAACTCCTTGCGGTCGGGTTTTGTGC
AGCGCTTCACCAGGCGGATTGAGTCCTTGGCGAAGGCGCGTCCGGGTTCG
GCGAATTTGACAACCTTGTCCATGTCGACTGATAACT

BS11068.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-PA 207 CG8860-RA 1..207 223..17 1035 100 Minus
CG14214-PA 207 CG14214-RA 1..200 223..24 475 89.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-RA 420 CG8860-RA 110..318 223..15 1045 100 Minus
Sec61gamma-RC 537 CG14214-RC 26..228 226..24 700 89.7 Minus
Sec61gamma-RB 792 CG14214-RB 158..360 226..24 700 89.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12179585..12179793 15..223 1045 100 Plus
X 23542271 X 19643884..19644086 226..24 700 89.7 Minus
2R 25286936 2R 20512745..20512877 25..157 200 76.7 Plus
Blast to na_te.dros performed 2015-02-13 09:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 3141..3178 51..15 106 78.9 Minus

BS11068.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:44 Download gff for BS11068.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-PA 1..207 17..223 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:42 Download gff for BS11068.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-PA 1..207 17..223 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 15:55:25 Download gff for BS11068.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..318 15..223 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:00:45 Download gff for BS11068.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..318 15..223 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:00:45 Download gff for BS11068.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12179585..12179791 15..221 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 15:55:25 Download gff for BS11068.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8067090..8067296 15..221 100 <- Plus

BS11068.5prime Sequence

237 bp (236 high quality bases) assembled on 2006-04-19

> BS11068.5prime
GAAGTTATCAGTCGACATGGACAAGGTTGTCAAATTCGCCGAACCCGGAC
GCGCCTTCGCCAAGGACTCAATCCGCCTGGTGAAGCGCTGCACAAAACCC
GACCGCAAGGAGTTCCAGAAAATCGCCATCGCCACCGCCGTGGGCTTCGC
CATCATGGGCTTCATCGGCTTCTTCGTCAAGCTGATTCACATTCCCATTA
ACAACATCATCGTGGGATCCTAGAAGCTTTCTAGACC

BS11068.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-PA 207 CG8860-RA 1..207 17..223 1035 100 Plus
CG14214-PA 207 CG14214-RA 1..200 17..216 475 89.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-RA 420 CG8860-RA 110..318 17..225 1045 100 Plus
Sec61gamma-RC 537 CG14214-RC 26..228 14..216 700 89.7 Plus
Sec61gamma-RB 792 CG14214-RB 158..360 14..216 700 89.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12179585..12179793 225..17 1045 100 Minus
X 23542271 X 19643884..19644086 14..216 700 89.7 Plus
2R 25286936 2R 20512745..20512877 215..83 200 76.7 Minus
Blast to na_te.dros performed 2015-02-11 10:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 3141..3178 189..225 106 78.9 Plus

BS11068.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:45 Download gff for BS11068.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-PA 1..207 17..223 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:44 Download gff for BS11068.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-PA 1..207 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 16:39:49 Download gff for BS11068.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..318 17..225 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:27:42 Download gff for BS11068.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..318 17..225 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:27:42 Download gff for BS11068.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12179585..12179791 19..225 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 16:39:49 Download gff for BS11068.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8067090..8067296 19..225 100 <- Minus

BS11068.complete Sequence

239 bp assembled on 2006-11-01

GenBank Submission: FJ636757

> BS11068.complete
GAAGTTATCAGTCGACATGGACAAGGTTGTCAAATTCGCCGAACCCGGAC
GCGCCTTCGCCAAGGACTCAATCCGCCTGGTGAAGCGCTGCACAAAACCC
GACCGCAAGGAGTTCCAGAAAATCGCCATCGCCACCGCCGTGGGCTTCGC
CATCATGGGCTTCATCGGCTTCTTCGTCAAGCTGATTCACATTCCCATTA
ACAACATCATCGTGGGATCCTAGAAGCTTTCTAGACCAT

BS11068.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-RA 207 CG8860-PA 1..207 17..223 1035 100 Plus
Sec61gamma-RC 207 CG14214-PC 1..200 17..216 685 89.5 Plus
Sec61gamma-RB 207 CG14214-PB 1..200 17..216 685 89.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-RA 420 CG8860-RA 110..318 17..225 1045 100 Plus
Sec61gamma-RC 537 CG14214-RC 26..228 14..216 700 89.7 Plus
Sec61gamma-RB 792 CG14214-RB 158..360 14..216 700 89.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12179585..12179793 225..17 1045 100 Minus
X 23542271 X 19643884..19644086 14..216 700 89.7 Plus
2R 25286936 2R 20512745..20512877 215..83 200 76.7 Minus
Blast to na_te.dros performed 2014-11-28 00:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 3141..3178 189..225 106 78.9 Plus

BS11068.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:44:28 Download gff for BS11068.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 1..207 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:31:42 Download gff for BS11068.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 46..254 17..225 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:02:03 Download gff for BS11068.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..316 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:44:28 Download gff for BS11068.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 46..254 17..225 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:28:44 Download gff for BS11068.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..316 17..223 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:28:44 Download gff for BS11068.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12179587..12179793 17..223 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:02:03 Download gff for BS11068.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8067092..8067298 17..223 100   Minus

BS11068.pep Sequence

Translation from 16 to 222

> BS11068.pep
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFI
GFFVKLIHIPINNIIVGS*

BS11068.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-PA 68 CG8860-PA 1..68 1..68 343 100 Plus
Sec61gamma-PC 68 CG14214-PC 1..68 1..68 339 98.5 Plus
Sec61gamma-PB 68 CG14214-PB 1..68 1..68 339 98.5 Plus
Sec61gamma-PA 68 CG14214-PA 1..68 1..68 339 98.5 Plus
CG13426-PA 105 CG13426-PA 48..104 10..66 196 64.9 Plus