Clone BS11071 Report

Search the DGRC for BS11071

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:110
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptDrs-RA
Protein status:BS11071.pep: full length peptide match
Sequenced Size:244

Clone Sequence Records

BS11071.3prime Sequence

242 bp (241 high quality bases) assembled on 2006-04-19

> BS11071.3prime
ATGGTCTAGAAACTTTTAGCATCCTTCGCACCAGCACTTCAGACTGGGGC
TGCAGTGGCCACTGGAGCGTCCCTCCTCCTTGCACACACGACGACAGGTC
TCGTTGTCCCAGACGGCACAGGGACCCTTGTATCTTCCGGACAGGCAGTC
GGCATCGGCCTCGTTGGCTCCCAGGACCACCAGCATCAGGACAGCGAAGA
GGGCGAACAAGTACTTGATCTGCATCATGTCGACTGATAACT

BS11071.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG10810-PA 213 Drs-RA 1..213 228..16 1065 100 Minus
CG10812-PA 210 dro5-RA 103..209 123..17 385 94.3 Minus
CG32268-PA 219 dro6-RA 53..131 176..98 220 91.1 Minus
CG32279-PA 213 dro2-RA 165..211 64..18 185 95.7 Minus
CG32274-PA 210 Drs-l-RA 161..210 65..16 175 94 Minus
CG32279-PA 213 dro2-RA 73..130 156..99 165 91.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-RA 387 CG10810-RA 64..277 228..15 1070 100 Minus
Drsl5-RA 364 CG10812-RA 104..263 176..17 560 90 Minus
Drsl2-RA 333 CG32279-RA 17..237 238..18 475 81 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 12:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3369619..3369832 228..15 1070 100 Minus
3L 28110227 3L 3316884..3317043 176..17 560 90 Minus
3L 28110227 3L 3314365..3314585 238..18 475 81 Minus
3L 28110227 3L 3336146..3336362 18..228 405 80.2 Plus
3L 28110227 3L 3335577..3335759 14..196 270 76.5 Plus
3L 28110227 3L 3315784..3315850 84..18 185 85.1 Minus
Blast to na_te.dros performed on 2015-02-11 12:17:37 has no hits.

BS11071.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:50 Download gff for BS11071.3prime
Subject Subject Range Query Range Percent Splice Strand
Drs-PA 1..213 16..228 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:52 Download gff for BS11071.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10810-PA 1..213 16..228 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 23:25:27 Download gff for BS11071.3prime
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..277 15..228 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 13:48:20 Download gff for BS11071.3prime
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..277 15..228 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 13:48:20 Download gff for BS11071.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 3369619..3369832 15..228 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 23:25:27 Download gff for BS11071.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3369619..3369832 15..228 100   Minus

BS11071.5prime Sequence

242 bp (241 high quality bases) assembled on 2006-04-19

> BS11071.5prime
GAAGTTATCAGTCGACATGATGCAGATCAAGTACTTGTTCGCCCTCTTCG
CTGTCCTGATGCTGGTGGTCCTGGGAGCCAACGAGGCCGATGCCGACTGC
CTGTCCGGAAGATACAAGGGTCCCTGTGCCGTCTGGGACAACGAGACCTG
TCGTCGTGTGTGCAAGGAGGAGGGACGCTCCAGTGGCCACTGCAGCCCCA
GTCTCGAGTGCTGGTGCGAAGGATGCTAAAAGTTTCTAGACC

BS11071.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG10810-PA 213 Drs-RA 1..213 17..229 1015 99 Plus
CG10812-PA 210 dro5-RA 103..209 122..228 335 92.5 Plus
CG32268-PA 219 dro6-RA 53..131 69..147 220 91.1 Plus
CG32279-PA 213 dro2-RA 73..130 89..146 165 91.3 Plus
CG32279-PA 213 dro2-RA 165..211 181..227 135 91.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-RA 387 CG10810-RA 64..277 17..230 1040 99.1 Plus
Drsl5-RA 364 CG10812-RA 104..263 69..228 530 88.8 Plus
Drsl2-RA 333 CG32279-RA 17..237 7..227 445 80.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3369619..3369832 17..230 1040 99.1 Plus
3L 28110227 3L 3316884..3317043 69..228 530 88.8 Plus
3L 28110227 3L 3314365..3314585 7..227 445 80.1 Plus
3L 28110227 3L 3336202..3336362 177..17 400 83.2 Minus
3L 28110227 3L 3335577..3335759 231..49 255 76 Minus
Blast to na_te.dros performed on 2015-02-11 10:52:07 has no hits.

BS11071.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:51 Download gff for BS11071.5prime
Subject Subject Range Query Range Percent Splice Strand
Drs-PA 1..213 17..229 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:54 Download gff for BS11071.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10810-PA 1..213 17..229 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 16:39:02 Download gff for BS11071.5prime
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..277 17..230 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:26:11 Download gff for BS11071.5prime
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..277 17..230 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:26:11 Download gff for BS11071.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 3369619..3369832 17..230 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 16:39:02 Download gff for BS11071.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3369619..3369832 17..230 99   Plus

BS11071.complete Sequence

244 bp assembled on 2009-05-14

GenBank Submission: KX803924

> BS11071.complete
GAAGTTATCAGTCGACATGATGCAGATCAAGTACTTGTTCGCCCTCTTCG
CTGTCCTGATGCTGGTGGTCCTGGGAGCCAACGAGGCCGATGCCGACTGC
CTGTCCGGAAGATACAAGGGTCCCTGTGCCGTCTGGGACAACGAGACCTG
TCGTCGTGTGTGCAAGGAGGAGGGACGCTCCAGTGGCCACTGCAGCCCCA
GTCTGAAGTGCTGGTGCGAAGGATGCTAAAAGTTTCTAGACCAT

BS11071.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-RA 213 CG10810-PA 1..213 17..229 1065 100 Plus
Drsl5-RA 210 CG10812-PA 50..209 69..228 560 90 Plus
Drsl2-RA 213 CG32279-PA 1..211 17..227 470 81.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-RA 387 CG10810-RA 64..277 17..230 1070 100 Plus
Drsl5-RA 364 CG10812-RA 104..263 69..228 560 90 Plus
Drsl2-RA 333 CG32279-RA 17..237 7..227 475 81 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3369619..3369832 17..230 1070 100 Plus
3L 28110227 3L 3316884..3317043 69..228 560 90 Plus
3L 28110227 3L 3314365..3314585 7..227 475 81 Plus
3L 28110227 3L 3336146..3336362 227..17 405 80.2 Minus
3L 28110227 3L 3335577..3335759 231..49 270 76.5 Minus
3L 28110227 3L 3315784..3315850 161..227 185 85.1 Plus
Blast to na_te.dros performed on 2014-11-27 01:27:58 has no hits.

BS11071.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:41:05 Download gff for BS11071.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 51..261 17..227 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:54:36 Download gff for BS11071.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..274 17..227 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:26:07 Download gff for BS11071.complete
Subject Subject Range Query Range Percent Splice Strand
Drs-RA 64..274 17..227 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:26:07 Download gff for BS11071.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3369619..3369829 17..227 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:54:36 Download gff for BS11071.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3369619..3369829 17..227 100   Plus

BS11071.pep Sequence

Translation from 16 to 228

> BS11071.pep
MMQIKYLFALFAVLMLVVLGANEADADCLSGRYKGPCAVWDNETCRRVCK
EEGRSSGHCSPSLKCWCEGC*

BS11071.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
Drs-PA 70 CG10810-PA 1..70 1..70 394 100 Plus
Drsl5-PA 69 CG10812-PA 1..69 2..70 338 82.6 Plus
Drsl2-PA 70 CG32279-PA 1..70 1..70 328 78.6 Plus
Drsl6-PA 72 CG32268-PA 1..72 1..70 324 77.8 Plus
Drsl1-PA 69 CG32274-PA 1..69 2..70 278 66.7 Plus