Clone Sequence Records
BS11072.5prime Sequence
261 bp (260 high quality bases) assembled on 2006-04-19
> BS11072.5prime
GAAGTTATCAGTCGACATGCTTAAGATTCCAAATCGGCGCAAGATGCCTG
TGTCAGAGCAACAGCCTCGAGTCATCAAGATAGAGCGACCAACGACTGGA
AGGATACTAGGTCCTTTGAACGTGGCCAGCATGCAGCAGCAGAACTTCTT
GGCCAAGAACAACCCAAAAATATCCGAAGATCTGGGCAGTCGCTTGCAGA
CTCTGCAGAGACGTGTCCAAGAGTGGAAGTCTTCAGGCCAAGTCTGAAAG
CTTTCTAGACC
BS11072.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:01:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8750-PA | 231 | CG8750-RA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:46:55
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8750-RB | 641 | CG8750-RB | 128..358 | 17..247 | 1155 | 100 | Plus |
| CG8750-RA | 452 | CG8750-RA | 128..358 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:46:52
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 13842660..13842890 | 247..17 | 1155 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 20:46:54 has no hits.
BS11072.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:57:52 Download gff for
BS11072.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8750-PA | 1..231 | 17..247 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:24:55 Download gff for
BS11072.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8750-PA | 1..231 | 17..247 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 04:00:44 Download gff for
BS11072.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8750-RA | 128..358 | 17..247 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:20:33 Download gff for
BS11072.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8750-RA | 128..358 | 17..247 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:20:33 Download gff for
BS11072.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 13842660..13842890 | 17..247 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 04:00:44 Download gff for
BS11072.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 13835760..13835990 | 17..247 | 100 | | Minus |
BS11072.complete Sequence
263 bp assembled on 2007-10-29
GenBank Submission: FJ636759
> BS11072.complete
GAAGTTATCAGTCGACATGCTTAAGATTCCAAATCGGCGCAAGATGCCTG
TGTCAGAGCAACAGCCTCGAGTCATCAAGATAGAGCGACCAACGACTGGA
AGGATACTAGGTCCTTTGAACGTGGCCAGCATGCAGCAGCAGAACTTCTT
GGCCAAGAACAACCCAAAAATATCCGAAGATCTGGGCAGTCGCTTGCAGA
CTCTGCAGAGACGTGTCCAAGAGTGGAAGTCTTCAGGCCAAGTCTGAAAG
CTTTCTAGACCAT
BS11072.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:18:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8750-RB | 231 | CG8750-PB | 1..231 | 17..247 | 1155 | 100 | Plus |
| CG8750-RA | 231 | CG8750-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:18:28
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8750-RB | 641 | CG8750-RB | 128..358 | 17..247 | 1155 | 100 | Plus |
| CG8750-RA | 452 | CG8750-RA | 128..358 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:18:25
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 13842660..13842890 | 247..17 | 1155 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 15:18:26 has no hits.
BS11072.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:13:40 Download gff for
BS11072.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8750-RA | 1..231 | 17..247 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:44:29 Download gff for
BS11072.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8750-RA | 128..358 | 17..247 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:39:35 Download gff for
BS11072.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8750-RA | 128..357 | 17..246 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:34:48 Download gff for
BS11072.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8750-RA | 128..357 | 17..246 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:04:42 Download gff for
BS11072.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8750-RA | 128..357 | 17..246 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:04:42 Download gff for
BS11072.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 13842661..13842890 | 17..246 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:39:35 Download gff for
BS11072.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 13835761..13835990 | 17..246 | 100 | | Minus |
BS11072.pep Sequence
Translation from 16 to 246
> BS11072.pep
MLKIPNRRKMPVSEQQPRVIKIERPTTGRILGPLNVASMQQQNFLAKNNP
KISEDLGSRLQTLQRRVQEWKSSGQV*
BS11072.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:33:30
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8750-PB | 76 | CG8750-PB | 1..76 | 1..76 | 384 | 100 | Plus |
| CG8750-PA | 76 | CG8750-PA | 1..76 | 1..76 | 384 | 100 | Plus |
