Clone BS11092 Report

Search the DGRC for BS11092

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:110
Well:92
Vector:pDNR-Dual
Associated Gene/Transcriptbaf-RA
Protein status:BS11092.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11092.5prime Sequence

303 bp (302 high quality bases) assembled on 2006-04-19

> BS11092.5prime
GAAGTTATCAGTCGACATGTCGGGCACATCGCAGAAACACAGGAACTTCG
TTGCGGAGCCAATGGGCAACAAGTCGGTGACGGAACTGGCCGGAATTGGG
GAAACCCTCGGTGGACGCTTGAAGGACGCTGGATTCGATATGGCCTACAC
CGTTTTGGGACAGTATCTGGTGCTGAAAAAGGACGAGGAGCTGTTCAAGG
ACTGGATGAAGGAGGTGTGCCACGCCAGCTCCAAACAGGCATCCGATTGC
TACAACTGTCTCAACGATTGGTGCGAGGAGTTCTTGTAAAAGCTTTCTAG
ACC

BS11092.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG7380-PA 273 CG7380-RA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
baf-RB 1022 CG7380-RB 145..419 15..289 1375 100 Plus
baf-RA 607 CG7380-RA 145..419 15..289 1375 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 20:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8029815..8029962 142..289 740 100 Plus
2L 23513712 2L 8029606..8029734 15..143 645 100 Plus
Blast to na_te.dros performed 2015-02-12 20:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 1624..1683 240..299 120 66.7 Plus

BS11092.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:58:35 Download gff for BS11092.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7380-PA 1..273 17..289 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:25:49 Download gff for BS11092.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7380-PA 1..273 17..289 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 11:53:15 Download gff for BS11092.5prime
Subject Subject Range Query Range Percent Splice Strand
baf-RA 142..422 9..292 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:33:06 Download gff for BS11092.5prime
Subject Subject Range Query Range Percent Splice Strand
baf-RA 142..422 9..292 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 01:33:06 Download gff for BS11092.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 8029603..8029733 9..142 97 -> Plus
2L 8029816..8029965 143..292 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 11:53:15 Download gff for BS11092.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8029603..8029733 9..142 97 -> Plus
arm_2L 8029816..8029965 143..292 99   Plus

BS11092.complete Sequence

305 bp assembled on 2007-10-29

GenBank Submission: FJ636769

> BS11092.complete
GAAGTTATCAGTCGACATGTCGGGCACATCGCAGAAACACAGGAACTTCG
TTGCGGAGCCAATGGGCAACAAGTCGGTGACGGAACTGGCCGGAATTGGG
GAAACCCTCGGTGGACGCTTGAAGGACGCTGGATTCGATATGGCCTACAC
CGTTTTGGGACAGTATCTGGTGCTGAAAAAGGACGAGGAGCTGTTCAAGG
ACTGGATGAAGGAGGTGTGCCACGCCAGCTCCAAACAGGCATCCGATTGC
TACAACTGTCTCAACGATTGGTGCGAGGAGTTCTTGTAAAAGCTTTCTAG
ACCAT

BS11092.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
baf-RB 273 CG7380-PB 1..273 17..289 1365 100 Plus
baf-RA 273 CG7380-PA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
baf-RB 1022 CG7380-RB 145..419 15..289 1375 100 Plus
baf-RA 607 CG7380-RA 145..419 15..289 1375 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8029815..8029962 142..289 740 100 Plus
2L 23513712 2L 8029606..8029734 15..143 645 100 Plus
Blast to na_te.dros performed 2014-11-27 13:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 1624..1683 240..299 120 66.7 Plus

BS11092.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:35:45 Download gff for BS11092.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 1..273 17..289 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:10:31 Download gff for BS11092.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 140..420 9..292 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:47:54 Download gff for BS11092.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 147..417 17..287 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:38:20 Download gff for BS11092.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 145..415 17..287 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:09:38 Download gff for BS11092.complete
Subject Subject Range Query Range Percent Splice Strand
baf-RA 147..417 17..287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:09:38 Download gff for BS11092.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8029608..8029733 17..142 100 -> Plus
2L 8029816..8029960 143..287 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:47:54 Download gff for BS11092.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8029608..8029733 17..142 100 -> Plus
arm_2L 8029816..8029960 143..287 100   Plus

BS11092.pep Sequence

Translation from 16 to 288

> BS11092.pep
MSGTSQKHRNFVAEPMGNKSVTELAGIGETLGGRLKDAGFDMAYTVLGQY
LVLKKDEELFKDWMKEVCHASSKQASDCYNCLNDWCEEFL*

BS11092.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
baf-PB 90 CG7380-PB 1..90 1..90 487 100 Plus
baf-PA 90 CG7380-PA 1..90 1..90 487 100 Plus