Clone BS11095 Report

Search the DGRC for BS11095

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:110
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG13117-RA
Protein status:BS11095.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11095.5prime Sequence

363 bp (362 high quality bases) assembled on 2006-04-19

> BS11095.5prime
GAAGTTATCAGTCGACATGGCAGCCGCAGTAGTCCAAAGTTTCGGCCAGG
AGGAGCTCTTCGTCAGCCGGGCCACAATTCAGTTGCAGTTGCCCCAGGGC
GGAGCCAGTTCGCCCATCTTCGAGTGGCGCACACAGGTGGCCACGCCCAC
GTCTGCCGCTGATCCCGCCCACGAGGAGAAGTGCATTAGTGGGCACCAGA
GCACGGAAGCTGCCACGCCCAAGAGCAATATCTACACGCCCCCACGAATC
CTGGGCACGGAGGCGAAGCGCAAGAATCTGCCCCAAACGTTGAGCAATTT
CTTCGAGGCGGAGCGCTACTCCAGCGCCTGGAATCGCGTGACCAAATAGA
AGCTTTCTAGACC

BS11095.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-PA 333 CG13117-RA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-RB 1305 CG13117-RB 66..398 17..349 1665 100 Plus
CG13117-RA 685 CG13117-RA 66..398 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9736710..9737042 17..349 1665 100 Plus
Blast to na_te.dros performed on 2015-02-13 01:41:46 has no hits.

BS11095.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:58:41 Download gff for BS11095.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13117-PA 1..333 17..349 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:25:58 Download gff for BS11095.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13117-PA 1..333 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 11:12:40 Download gff for BS11095.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 58..404 8..358 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:28:14 Download gff for BS11095.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 58..404 8..358 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:28:14 Download gff for BS11095.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 9736710..9737048 17..358 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 11:12:40 Download gff for BS11095.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9736710..9737048 17..358 98   Plus

BS11095.3prime Sequence

363 bp (362 high quality bases) assembled on 2006-04-19

> BS11095.3prime
ATGGTCTAGAAAGCTTCTATTTGGTCACGCGATTCCAGGCGCTGGAGTAG
CGCTCCGCCTCGAAGAAATTGCTCAACGTTTGGGGCAGATTCTTGCGCTT
CGCCTCCGTGCCCAGGATTCGTGGGGGCGTGTAGATATTGCTCTTGGGCG
TGGCAGCTTCCGTGCTCTGGTGCCCACTAATGCACTTCTCCTCGTGGGCG
GGATCAGCGGCAGACGTGGGCGTGGCCACCTGTGTGCGCCACTCGAAGAT
GGGCGAACTGGCTCCGCCCTGGGGCAACTGCAACTGAATTGTGGCCCGGC
TGACGAAGAGCTCCTCCTGGCCGAAACTTTGGACTACTGCGGCTGCCATG
TCGACTGATAACT

BS11095.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-PA 333 CG13117-RA 1..333 349..17 1665 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-RB 1305 CG13117-RB 66..398 349..17 1665 100 Minus
CG13117-RA 685 CG13117-RA 66..398 349..17 1665 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9736710..9737042 349..17 1665 100 Minus
Blast to na_te.dros performed on 2015-02-12 04:44:48 has no hits.

BS11095.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 10:58:40 Download gff for BS11095.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13117-PA 1..333 17..349 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:25:57 Download gff for BS11095.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13117-PA 1..333 17..349 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 23:28:30 Download gff for BS11095.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 58..404 8..358 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:04:20 Download gff for BS11095.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 58..404 8..358 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:04:20 Download gff for BS11095.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 9736710..9737048 8..349 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 23:28:30 Download gff for BS11095.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9736710..9737048 8..349 98   Minus

BS11095.complete Sequence

365 bp assembled on 2006-11-01

GenBank Submission: FJ636772

> BS11095.complete
GAAGTTATCAGTCGACATGGCAGCCGCAGTAGTCCAAAGTTTCGGCCAGG
AGGAGCTCTTCGTCAGCCGGGCCACAATTCAGTTGCAGTTGCCCCAGGGC
GGAGCCAGTTCGCCCATCTTCGAGTGGCGCACACAGGTGGCCACGCCCAC
GTCTGCCGCTGATCCCGCCCACGAGGAGAAGTGCATTAGTGGGCACCAGA
GCACGGAAGCTGCCACGCCCAAGAGCAATATCTACACGCCCCCACGAATC
CTGGGCACGGAGGCGAAGCGCAAGAATCTGCCCCAAACGTTGAGCAATTT
CTTCGAGGCGGAGCGCTACTCCAGCGCCTGGAATCGCGTGACCAAATAGA
AGCTTTCTAGACCAT

BS11095.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-RB 333 CG13117-PB 1..333 17..349 1665 100 Plus
CG13117-RA 333 CG13117-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-RB 1305 CG13117-RB 66..398 17..349 1665 100 Plus
CG13117-RA 685 CG13117-RA 66..398 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9736710..9737042 17..349 1665 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:24:04 has no hits.

BS11095.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:39:52 Download gff for BS11095.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 1..333 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:16:47 Download gff for BS11095.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 58..404 8..358 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:56:01 Download gff for BS11095.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 66..392 17..343 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:39:53 Download gff for BS11095.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 58..404 8..358 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:17:41 Download gff for BS11095.complete
Subject Subject Range Query Range Percent Splice Strand
CG13117-RA 66..392 17..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:17:41 Download gff for BS11095.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9736710..9737036 17..343 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:56:01 Download gff for BS11095.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9736710..9737036 17..343 100   Plus

BS11095.pep Sequence

Translation from 16 to 348

> BS11095.pep
MAAAVVQSFGQEELFVSRATIQLQLPQGGASSPIFEWRTQVATPTSAADP
AHEEKCISGHQSTEAATPKSNIYTPPRILGTEAKRKNLPQTLSNFFEAER
YSSAWNRVTK*

BS11095.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13117-PB 110 CG13117-PB 1..110 1..110 566 100 Plus
CG13117-PA 110 CG13117-PA 1..110 1..110 566 100 Plus