Clone BS11166 Report

Search the DGRC for BS11166

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:111
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptmRpL33-RA
Protein status:BS11166.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS11166.5prime Sequence

225 bp (224 high quality bases) assembled on 2006-04-19

> BS11166.5prime
GAAGTTATCAGTCGACATGCGTCTAACTAACGTTTTGTTCAAAAAGGTGA
AGAGCAAGCGCATCATGGTCGTACTGGAAAGTGTGGTCAGTGGACATCAG
TTTAATGCTTTTCGCGATCGCTTGGCCGACAAATTGGAGATAATACGCTT
CGATCCGTACATTCAACAGGAAAGCCTTTATCGTGAACGCAAGAAAATCC
GCAGCGCCTAAAAGCTTTCTAGACC

BS11166.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG3712-PA 195 mRpL33-RA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-RA 349 CG3712-RA 101..295 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4321931..4322034 161..58 520 100 Minus
X 23542271 X 4321818..4321867 211..162 250 100 Minus
X 23542271 X 4322090..4322131 58..17 210 100 Minus
Blast to na_te.dros performed on 2015-02-13 01:39:49 has no hits.

BS11166.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:00:42 Download gff for BS11166.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3712-PA 1..195 17..211 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:28:35 Download gff for BS11166.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3712-PA 1..195 17..211 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 11:12:12 Download gff for BS11166.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 88..295 5..211 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:21:10 Download gff for BS11166.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 88..295 5..211 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:21:10 Download gff for BS11166.5prime
Subject Subject Range Query Range Percent Splice Strand
X 4321818..4321867 162..211 100 <- Minus
X 4321931..4322034 58..161 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 11:12:12 Download gff for BS11166.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4215851..4215900 162..211 100 <- Minus
arm_X 4215964..4216067 58..161 100 <- Minus

BS11166.3prime Sequence

225 bp (224 high quality bases) assembled on 2006-04-19

> BS11166.3prime
ATGGTCTAGAAAGCTTTTAGGCGCTGCGGATTTTCTTGCGTTCACGATAA
AGGCTTTCCTGTTGAATGTACGGATCGAAGCGTATTATCTCCAATTTGTC
GGCCAAGCGATCGCGAAAAGCATTAAACTGATGTCCACTGACCACACTTT
CCAGTACGACCATGATGCGCTTGCTCTTCACCTTTTTGAACAAAACGTTA
GTTAGACGCATGTCGACTGATAACT

BS11166.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG3712-PA 195 mRpL33-RA 1..195 211..17 975 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-RA 349 CG3712-RA 101..295 211..17 975 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 18:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4321931..4322034 67..170 520 100 Plus
X 23542271 X 4321818..4321867 17..66 250 100 Plus
X 23542271 X 4322090..4322131 170..211 210 100 Plus
Blast to na_te.dros performed on 2015-02-12 18:47:37 has no hits.

BS11166.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:00:41 Download gff for BS11166.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3712-PA 1..195 17..211 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:28:34 Download gff for BS11166.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3712-PA 1..195 17..211 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 04:22:30 Download gff for BS11166.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 88..295 17..223 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:28:16 Download gff for BS11166.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 88..295 17..223 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:28:16 Download gff for BS11166.3prime
Subject Subject Range Query Range Percent Splice Strand
X 4321818..4321867 17..66 100 <- Plus
X 4321931..4322034 67..170 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 04:22:30 Download gff for BS11166.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4215851..4215900 17..66 100 <- Plus
arm_X 4215964..4216067 67..170 100 <- Plus

BS11166.complete Sequence

227 bp assembled on 2006-11-01

GenBank Submission: FJ636774

> BS11166.complete
GAAGTTATCAGTCGACATGCGTCTAACTAACGTTTTGTTCAAAAAGGTGA
AGAGCAAGCGCATCATGGTCGTACTGGAAAGTGTGGTCAGTGGACATCAG
TTTAATGCTTTTCGCGATCGCTTGGCCGACAAATTGGAGATAATACGCTT
CGATCCGTACATTCAACAGGAAAGCCTTTATCGTGAACGCAAGAAAATCC
GCAGCGCCTAAAAGCTTTCTAGACCAT

BS11166.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:27:50
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-RA 195 CG3712-PA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-RA 349 CG3712-RA 101..295 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4321931..4322034 161..58 520 100 Minus
X 23542271 X 4321818..4321867 211..162 250 100 Minus
X 23542271 X 4322090..4322131 58..17 210 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:27:49 has no hits.

BS11166.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:01 Download gff for BS11166.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..195 17..211 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:33:27 Download gff for BS11166.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 58..265 5..211 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:46:27 Download gff for BS11166.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 101..293 17..209 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:01 Download gff for BS11166.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 58..265 5..211 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:18:56 Download gff for BS11166.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 101..293 17..209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:18:56 Download gff for BS11166.complete
Subject Subject Range Query Range Percent Splice Strand
X 4321820..4321867 162..209 100 <- Minus
X 4321931..4322034 58..161 100 <- Minus
X 4322091..4322131 17..57 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:46:27 Download gff for BS11166.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4215853..4215900 162..209 100 <- Minus
arm_X 4215964..4216067 58..161 100 <- Minus
arm_X 4216124..4216164 17..57 100   Minus

BS11166.pep Sequence

Translation from 16 to 210

> BS11166.pep
MRLTNVLFKKVKSKRIMVVLESVVSGHQFNAFRDRLADKLEIIRFDPYIQ
QESLYRERKKIRSA*

BS11166.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-PA 64 CG3712-PA 1..64 1..64 314 100 Plus